Aliases for MAST1 Gene
Aliases for MAST1 Gene
External Ids for MAST1 Gene
- HGNC: 19034
- Entrez Gene: 22983
- Ensembl: ENSG00000105613
- OMIM: 612256
- UniProtKB: Q9Y2H9
Previous GeneCards Identifiers for MAST1 Gene
- GC19U900423
- GC19P012811
- GC19P012949
- GC19P012520
Summaries for MAST1 Gene
-
This gene is a member of the microtubule-associated serine/threonine kinase (MAST) family. The protein encoded by this gene has an N-terminal serine/threonine kinase domain followed by a postsynaptic density protein-95/discs large/zona occludens-1 (PDZ) domain. In mouse and rat, the orthologous protein associates with the cytoskeleton and can bind both beta-2-syntrophin and neuronal nitric oxide synthase (nNOS) through its PDZ domain. In mouse and rat, this protein also co-localizes with dystrophin- and utrophin-associated protein complexes (DAPC/UAPC) in the vascular endothelium of the central nervous system. [provided by RefSeq, May 2017]
GeneCards Summary for MAST1 Gene
MAST1 (Microtubule Associated Serine/Threonine Kinase 1) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAST2.
UniProtKB/Swiss-Prot for MAST1 Gene
-
Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAST1 Gene
Genomics for MAST1 Gene
Regulatory Elements for MAST1 Gene
Enhancers for MAST1 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around MAST1 on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the MAST1 gene promoter:
Regulatory Element Products
Genomic Location for MAST1 Gene
- Chromosome:
- 19
- Start:
- 12,833,934 bp from pter
- End:
- 12,874,953 bp from pter
- Size:
- 41,020 bases
- Orientation:
- Plus strand
Genomic View for MAST1 Gene
Genes around MAST1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 19p13.13 by Ensembl
- 19p13.13 by Entrez Gene
- 19p13.2 by HGNC
MAST1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MAST1 Gene
Proteins for MAST1 Gene
-
Protein details for MAST1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9Y2H9-MAST1_HUMAN
- Recommended name:
- Microtubule-associated serine/threonine-protein kinase 1
- Protein Accession:
- Q9Y2H9
- O00114
- Q8N6X0
Protein attributes for MAST1 Gene
- Size:
- 1570 amino acids
- Molecular mass:
- 170677 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Part of a low affinity complex that associates with, but is distinct from, the postsynaptic density. Interacts with SNTB2 (By similarity).
- SequenceCaution:
-
- Sequence=AAB51171.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAH27985.2; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA76817.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for MAST1 Gene
Selected DME Specific Peptides for MAST1 Gene
- Q9Y2H9:
-
- MMNHVYKERFPKATAQMEE
- SYKAKMARR
- PRYIIRQLGL
- MFCSFET
- AETVLALEYLH
- LYEFLVGCVPFFGDTPEELFGQV
- RPRSRSL
- CSFETRRHLCMVMEYVEGGDCATL
- CGTPEYIAPE
- HIRPSTLHGL
- ELARDCL
- KRSSLFRKITKQ
- DNEIVMMNHVY
- DELHFLSKHF
- KSAGNIPLSPLA
- RSLSPGR
- GKPVDWWA
- RPARLLECLEF
- PRSPLLKRVQS
- EVVELILKSGNKVA
- GHIKLTDFGLSK
- IKLTDFG
- KVIKSASATALS
- WPEGDEALP
- LLHTSRSLSSLNRSLSS
- EVKQHSFF
- GIVHRDLKPDN
- KVYSSME
- LHQLPYQPT
- FVERDILTFAENPFVV
- LLEAAEGHAKEG
- RFSKVYSS
- SPLASPMSP
- RHLCMVMEYVEGGDCATLLKNIGALPV
- LTDFGLSK
- KLTDFGL
- DGRRWSLASLPSSGYGTNTPSSTVSSSCSSQE
- SYRSTPD
- TIKLISNGAYGAVYLVRHRDTRQRFA
- LSFIHHQ
- TTTPFENTSI
- LPRPHSPL
- GHIKLTD
- LDWTGLLRQKAEFIP
- NLEKLLQDA
- VHRDLKP
- IVHRDLK
Post-translational modifications for MAST1 Gene
Other Protein References for MAST1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for MAST1
- Invitrogen Antibodies for MAST1
- antibodies-online Antibodies for MAST1: See all 12
- GeneTex MAST1 antibody for MAST1
-
Santa Cruz Biotechnology (SCBT) Antibodies for MAST1
Protein Products
-
OriGene Purified Proteins for MAST1
- Search Origene for MassSpec and Protein Over-expression Lysates for MAST1
- Origene Custom Protein Services for MAST1
- Search GeneTex for Proteins for MAST1
Assay Products
- antibodies-online Kits for MAST1: See all 3
Domains & Families for MAST1 Gene
Gene Families for MAST1 Gene
Protein Domains for MAST1 Gene
Suggested Antigen Peptide Sequences for MAST1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9Y2H9UniProtKB/Swiss-Prot:
MAST1_HUMAN :- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Function for MAST1 Gene
Molecular function for MAST1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).
Enzyme Numbers (IUBMB) for MAST1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000287 | magnesium ion binding | IEA,ISS | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | IEA,ISS | -- |
| GO:0005515 | protein binding | IPI | 20029029 |
| GO:0005524 | ATP binding | ISS,IEA | -- |
Phenotypes for MAST1 Gene
- GenomeRNAi human phenotypes for MAST1:
-
- Increased vaccinia virus (VACV) infection
- Decreased hepcidin::fluc mRNA expression
- shRNA abundance <= 50%
- Lamellipodia cells
- Decreased viability ratio
- Increased transferrin (TF) endocytosis
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased cell migration
- Decreased homologous recombination repair frequency
- Weakly decreased NFAT1-GFP nuclear translocation
- Increased Nanog expression
- Condensed cis-Golgi
Animal Model Products
-
Taconic Biosciences Mouse Models for MAST1
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAST1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
- Search ViGene Biosciences for MAST1
CRISPR Products
-
OriGene CRISPR knockouts for MAST1
-
Applied Biological Materials CRISPR for MAST1
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
miRNA for MAST1 Gene
- miRTarBase miRNAs that target MAST1
miRNA Products
- Search ViGene Biosciences for MAST1
Inhibitory RNA Products
- Origene RNAi, rat_shrna, siRNA, and shRNA products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for MAST1
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for MAST1
-
ViGene Biosciences adenoviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAST1 Gene
Localization for MAST1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MAST1 Gene
- Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Note=Colocalizes with syntrophins at the cell membrane. {ECO:0000250}.
| Compartment | Confidence |
|---|---|
| plasma membrane | 4 |
| cytoskeleton | 3 |
| cytosol | 3 |
| nucleus | 2 |
| mitochondrion | 1 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005622 | intracellular | IEA,IBA | -- |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005856 | cytoskeleton | IEA | -- |
| GO:0005886 | plasma membrane | IEA | -- |
| GO:0016020 | membrane | IEA | -- |
Pathways & Interactions for MAST1 Gene
No Data Available
Interacting Proteins for MAST1 Gene
Selected Interacting proteins:
ENSP00000251472
Q9Y2H9-MAST1_HUMAN
for MAST1 Gene via
STRING
UniProtKB
IID
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA,ISS | -- |
| GO:0007010 | cytoskeleton organization | ISS,IEA | -- |
| GO:0016310 | phosphorylation | IEA | -- |
| GO:0018105 | peptidyl-serine phosphorylation | IBA | -- |
| GO:0035556 | intracellular signal transduction | IEA,ISS | -- |
No data available for Pathways by source for MAST1 Gene
Drugs & Compounds for MAST1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for MAST1 Gene
mRNA/cDNA for MAST1 Gene
- (4) REFSEQ mRNAs :
- (5) Additional mRNA sequences :
- (89) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for MAST1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for MAST1
-
Applied Biological Materials CRISPR for MAST1
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
miRNA Products
- Search ViGene Biosciences for MAST1
Inhibitory RNA Products
- Origene RNAi, rat_shrna, siRNA, and shRNA products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for MAST1
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | · | 7c | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 | ^ | 11 | ^ | 12a | · | 12b | · | 12c | ^ | 13 | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: |
| ExUns: | 21a | · | 21b | ^ | 22 | ^ | 23 | ^ | 24 | ^ | 25a | · | 25b | ^ | 26a | · | 26b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | |||||||||||||||
| SP2: | |||||||||||||||||
| SP3: | |||||||||||||||||
| SP4: | |||||||||||||||||
| SP5: | |||||||||||||||||
| SP6: | |||||||||||||||||
| SP7: | |||||||||||||||||
| SP8: |
Expression for MAST1 Gene
mRNA differential expression in normal tissues according to GTEx for MAST1 Gene
This gene is overexpressed in Brain - Cerebellum (x9.6), Brain - Cerebellar Hemisphere (x9.0), Brain - Cortex (x6.4), and Brain - Frontal Cortex (BA9) (x4.5).
This gene is overexpressed in Serum (47.6), Fetal Brain (11.1), and Frontal cortex (6.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAST1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of MAST1 Gene:
MAST1SOURCE GeneReport for Unigene cluster for MAST1 Gene:
Hs.227489Evidence on tissue expression from TISSUES for MAST1 Gene
- Nervous system(4.6)
Primer Products
-
OriGene qPCR primer pairs for MAST1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAST1 Gene
Orthologs for MAST1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | MAST1 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | -- 35 |
|
OneToMany | |
| -- 35 |
|
OneToMany | |||
| MAST1 34 |
|
||||
| cow (Bos Taurus) |
Mammalia | MAST1 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | MAST1 35 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | MAST1 35 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Mast1 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | MAST1 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | MAST1 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | mast1 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | mast1a 34 35 |
|
||
| mast1b 35 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | CG6498 35 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | kin-4 35 |
|
OneToMany | |
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | KIN82 35 |
|
ManyToMany | |
| FPK1 35 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
OneToMany |
- Species where no ortholog for MAST1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for MAST1 Gene
(27) SIMAP similar genes for MAST1 Gene using alignment to 4 proteins:
Variants for MAST1 Gene
| SNP ID | Clin | Chr 19 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| VAR_040768 | A metastatic melanoma sample | ||||
| VAR_040769 | An ovarian serous carcinoma sample | ||||
| rs878853165 | Likely pathogenic | 12,843,558(+) | GGCCT(C/T)GCTCC | reference, missense | |
| rs1000101137 | -- | 12,855,013(+) | ATCAC(G/T)TGAGG | intron-variant | |
| rs1000101908 | -- | 12,873,257(+) | GCCGT(G/T)AAATG | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2663622 | CNV | deletion | 23128226 |
| esv3643714 | CNV | loss | 21293372 |
| nsv1153883 | CNV | duplication | 26484159 |
| nsv2420 | CNV | insertion | 18451855 |
| nsv953977 | CNV | deletion | 24416366 |
Residual Variation Intolerance Score:
1.29% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.34;
26.62% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for MAST1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAST1 Gene
Disorders for MAST1 Gene
Relevant External Links for MAST1
- Atlas of Genetics and Cytogenetics in Oncology and Haematology:
- MAST1
No disorders were found for MAST1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MAST1 Gene
Publications for MAST1 Gene
- The DNA sequence and biology of human chromosome 19. (PMID: 15057824) Grimwood J. … Lucas S.M. (Nature 2004) 3 4 64
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
- Sast124, a novel splice variant of syntrophin-associated serine/threonine kinase (SAST), is specifically localized in the restricted brain regions. (PMID: 12614677) Yano R. … Hashikawa T. (Neuroscience 2003) 3 22 64
- Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10231032) Nagase T. … Ohara O. (DNA Res. 1999) 3 4 64
- Interactions between beta 2-syntrophin and a family of microtubule-associated serine/threonine kinases. (PMID: 10404183) Lumeng C. … Chamberlain J.S. (Nat. Neurosci. 1999) 3 22 64
Products for MAST1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for MAST1
- Search Origene for MassSpec and Protein Over-expression Lysates for MAST1
- Origene Custom Protein Services for MAST1
- Origene shRNA, siRNA, rat_shrna, and RNAi products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
- OriGene qPCR primer pairs for MAST1
- OriGene CRISPR knockouts for MAST1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MAST1
- GenScript: Next-day shipping of latest version cDNA ORF clones for MAST1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for MAST1
- GenScript Custom Assay Services for MAST1
- GenScript Custom overexpressing Cell Line Services for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for MAST1
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for MAST1
- Novus Biologicals proteins and lysates for MAST1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for MAST1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for MAST1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for MAST1
- antibodies-online Antibodies for MAST1: See all 12
- antibodies-online Kits for MAST1: See all 3
- Search antibodies-online for proteins
- Search antibodies-online for peptides
- GeneTex MAST1 antibody for MAST1
- Search GeneTex for Proteins for MAST1
- ViGene Biosciences adenoviral particle packaged cDNA for MAST1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
- Search ViGene Biosciences for MAST1
- Santa Cruz Biotechnology (SCBT) Antibodies for MAST1
- Search Santa Cruz Biotechnology (SCBT) for MAST1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- Horizon Cell Lines for MAST1
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAST1
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for MAST1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus Biologicals
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer
- (156) abm
- (157) CrownBio