Aliases for MAST1 Gene
Aliases for MAST1 Gene
External Ids for MAST1 Gene
- HGNC: 19034
- Entrez Gene: 22983
- Ensembl: ENSG00000105613
- OMIM: 612256
- UniProtKB: Q9Y2H9
Previous GeneCards Identifiers for MAST1 Gene
- GC19U900423
- GC19P012811
- GC19P012949
- GC19P012520
Summaries for MAST1 Gene
-
This gene is a member of the microtubule-associated serine/threonine kinase (MAST) family. The protein encoded by this gene has an N-terminal serine/threonine kinase domain followed by a postsynaptic density protein-95/discs large/zona occludens-1 (PDZ) domain. In mouse and rat, the orthologous protein associates with the cytoskeleton and can bind both beta-2-syntrophin and neuronal nitric oxide synthase (nNOS) through its PDZ domain. In mouse and rat, this protein also co-localizes with dystrophin- and utrophin-associated protein complexes (DAPC/UAPC) in the vascular endothelium of the central nervous system. [provided by RefSeq, May 2017]
GeneCards Summary for MAST1 Gene
MAST1 (Microtubule Associated Serine/Threonine Kinase 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAST2.
UniProtKB/Swiss-Prot for MAST1 Gene
-
Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).
Additional gene information for MAST1 Gene
- Monarch Initiative
- Search for MAST1 at DataMed
- Search for MAST1 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAST1 Gene
Genomics for MAST1 Gene
GeneHancer (GH) Regulatory Elements for MAST1 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH19I012838 | Promoter/Enhancer | 1.8 | EPDnew Ensembl ENCODE | 550.8 | +4.5 | 4530 | 0.3 | RB1 ZNF335 EGR1 ZNF143 RCOR1 CREM EGR2 SMARCA5 REST ZNF398 | RTBDN MAST1 GC19M012844 HOOK2 | |
GH19I012833 | Promoter/Enhancer | 1.8 | EPDnew Ensembl ENCODE | 550.8 | +0.3 | 323 | 1 | HDAC1 HDGF RB1 KLF17 NFXL1 ZNF335 GLIS2 EGR1 ATF7 EGR2 | MAST1 RTBDN HOOK2 | |
GH19I012832 | Enhancer | 1 | ENCODE | 550.8 | -1.3 | -1342 | 0.2 | MLX ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF766 | MAST1 CCDC130 ZNF564 WDR83OS ZNF791 MRI1 ZNF700 ZNF44 TRMT1 ZNF799 | |
GH19I012834 | Enhancer | 0.9 | ENCODE | 550.8 | -1.6 | -1572 | 0.1 | ATF1 ARNT ARID4B SIN3A ZNF48 ZNF207 ZNF143 PAF1 ZNF263 NCOA1 | MAST1 CCDC130 ZNF564 WDR83OS ZNF791 MRI1 ZNF700 ZNF44 TRMT1 ZNF799 | |
GH19I012836 | Enhancer | 0.4 | ENCODE | 550.8 | -0.4 | -392 | 0.2 | ZNF639 VEZF1 | MAST1 RTBDN GC19M012828 HOOK2 |
Regulatory Element Products
Genomic Locations for MAST1 Gene
- chr19:12,833,934-12,874,953
- (GRCh38/hg38)
- Size:
- 41,020 bases
- Orientation:
- Plus strand
- chr19:12,944,765-12,985,766
- (GRCh37/hg19)
Genomic View for MAST1 Gene
- Cytogenetic band:
-
- 19p13.13 by Ensembl
- 19p13.13 by Entrez Gene
- 19p13.2 by HGNC


RefSeq DNA sequence for MAST1 Gene
Proteins for MAST1 Gene
-
Protein details for MAST1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9Y2H9-MAST1_HUMAN
- Recommended name:
- Microtubule-associated serine/threonine-protein kinase 1
- Protein Accession:
- Q9Y2H9
- O00114
- Q8N6X0
Protein attributes for MAST1 Gene
- Size:
- 1570 amino acids
- Molecular mass:
- 170677 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Part of a low affinity complex that associates with, but is distinct from, the postsynaptic density. Interacts with SNTB2 (By similarity).
- SequenceCaution:
-
- Sequence=AAB51171.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAH27985.2; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA76817.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for MAST1 Gene
Selected DME Specific Peptides for MAST1 Gene
- Q9Y2H9:
-
- MMNHVYKERFPKATAQMEE
- SYKAKMARR
- PRYIIRQLGL
- MFCSFET
- AETVLALEYLH
- LYEFLVGCVPFFGDTPEELFGQV
- RPRSRSL
- CSFETRRHLCMVMEYVEGGDCATL
- CGTPEYIAPE
- HIRPSTLHGL
- ELARDCL
- KRSSLFRKITKQ
- DNEIVMMNHVY
- DELHFLSKHF
- KSAGNIPLSPLA
- RSLSPGR
- GKPVDWWA
- RPARLLECLEF
- PRSPLLKRVQS
- EVVELILKSGNKVA
- GHIKLTDFGLSK
- IKLTDFG
- KVIKSASATALS
- WPEGDEALP
- LLHTSRSLSSLNRSLSS
- EVKQHSFF
- GIVHRDLKPDN
- KVYSSME
- LHQLPYQPT
- FVERDILTFAENPFVV
- LLEAAEGHAKEG
- RFSKVYSS
- SPLASPMSP
- RHLCMVMEYVEGGDCATLLKNIGALPV
- LTDFGLSK
- KLTDFGL
- DGRRWSLASLPSSGYGTNTPSSTVSSSCSSQE
- SYRSTPD
- TIKLISNGAYGAVYLVRHRDTRQRFA
- LSFIHHQ
- TTTPFENTSI
- LPRPHSPL
- GHIKLTD
- LDWTGLLRQKAEFIP
- NLEKLLQDA
- VHRDLKP
- IVHRDLK
Post-translational modifications for MAST1 Gene
Other Protein References for MAST1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for MAST1
- Invitrogen Antibodies for MAST1
- GeneTex MAST1 antibody for MAST1
-
Santa Cruz Biotechnology (SCBT) Antibodies for MAST1
Protein Products
-
OriGene Purified Proteins for MAST1
- Search Origene for MassSpec and Protein Over-expression Lysates for MAST1
- Origene Custom Protein Services for MAST1
- Search GeneTex for Proteins for MAST1
Assay Products
- antibodies-online: Search results for 3 available MAST1 Elisa Kits ranked by validation data
- Compare Top MAST1 Elisa Kits
-
Quality Products:
Domains & Families for MAST1 Gene
Gene Families for MAST1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for MAST1 Gene
Suggested Antigen Peptide Sequences for MAST1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9Y2H9UniProtKB/Swiss-Prot:
MAST1_HUMAN :- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Function for MAST1 Gene
Molecular function for MAST1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins (By similarity).
Enzyme Numbers (IUBMB) for MAST1 Gene
Phenotypes From GWAS Catalog for MAST1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000287 | magnesium ion binding | ISS,IEA | -- |
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004674 | protein serine/threonine kinase activity | IEA,ISS | -- |
GO:0005515 | protein binding | IPI | 20029029 |
GO:0005524 | ATP binding | IEA,ISS | -- |
Phenotypes for MAST1 Gene
- GenomeRNAi human phenotypes for MAST1:
-
- Increased vaccinia virus (VACV) infection
- Decreased hepcidin::fluc mRNA expression
- shRNA abundance <= 50%
- Lamellipodia cells
- Decreased viability ratio
- Increased transferrin (TF) endocytosis
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased cell migration
- Decreased homologous recombination repair frequency
- Weakly decreased NFAT1-GFP nuclear translocation
- Increased Nanog expression
- Condensed cis-Golgi
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAST1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
- Search ViGene Biosciences for MAST1
CRISPR Products
-
OriGene CRISPR knockouts for MAST1
- genomics-online: gRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- Applied Biological Materials CRISPR for MAST1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
miRNA for MAST1 Gene
- miRTarBase miRNAs that target MAST1
miRNA Products
- Search ViGene Biosciences for MAST1
Inhibitory RNA Products
- Origene RNAi, shrna, and sirna products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
- genomics-online: shRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for MAST1
- Applied Biological Materials Clones for MAST1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for MAST1
-
ViGene Biosciences adenoviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAST1 Gene
Localization for MAST1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MAST1 Gene
- Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Note=Colocalizes with syntrophins at the cell membrane. {ECO:0000250}.
- Vesicles (2)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005622 | intracellular | IBA,IEA | -- |
GO:0005737 | cytoplasm | IEA | -- |
GO:0005856 | cytoskeleton | IEA | -- |
GO:0005886 | plasma membrane | IEA | -- |
GO:0016020 | membrane | IEA | -- |
Pathways & Interactions for MAST1 Gene
Interacting Proteins for MAST1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | ISS,IEA | -- |
GO:0007010 | cytoskeleton organization | ISS,IEA | -- |
GO:0016310 | phosphorylation | IEA | -- |
GO:0018105 | peptidyl-serine phosphorylation | IBA | -- |
GO:0035556 | intracellular signal transduction | ISS,IEA | -- |
No data available for Pathways by source for MAST1 Gene
Drugs & Compounds for MAST1 Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for MAST1 Gene
mRNA/cDNA for MAST1 Gene
- (4) REFSEQ mRNAs :
- (5) Additional mRNA sequences :
- (89) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for MAST1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for MAST1
- genomics-online: gRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- Applied Biological Materials CRISPR for MAST1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
miRNA Products
- Search ViGene Biosciences for MAST1
Inhibitory RNA Products
- Origene RNAi, shrna, and sirna products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
- genomics-online: shRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for MAST1
- Applied Biological Materials Clones for MAST1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | · | 7c | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 | ^ | 11 | ^ | 12a | · | 12b | · | 12c | ^ | 13 | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: |
ExUns: | 21a | · | 21b | ^ | 22 | ^ | 23 | ^ | 24 | ^ | 25a | · | 25b | ^ | 26a | · | 26b |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | |||||||||||||||
SP2: | |||||||||||||||||
SP3: | |||||||||||||||||
SP4: | |||||||||||||||||
SP5: | |||||||||||||||||
SP6: | |||||||||||||||||
SP7: | |||||||||||||||||
SP8: |
Expression for MAST1 Gene
mRNA differential expression in normal tissues according to GTEx for MAST1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAST1 Gene
NURSA nuclear receptor signaling pathways regulating expression of MAST1 Gene:
MAST1SOURCE GeneReport for Unigene cluster for MAST1 Gene:
Hs.227489Evidence on tissue expression from TISSUES for MAST1 Gene
- Nervous system(4.6)
Primer Products
-
OriGene qPCR primer pairs for MAST1
- genomics-online: primer clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAST1 Gene
Orthologs for MAST1 Gene
This gene was present in the common ancestor of animals and fungi.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | MAST1 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | -- 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
MAST1 33 |
|
||||
cow (Bos Taurus) |
Mammalia | MAST1 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | MAST1 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | MAST1 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Mast1 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | MAST1 33 |
|
||
lizard (Anolis carolinensis) |
Reptilia | MAST1 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | mast1 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | mast1a 33 34 |
|
||
mast1b 34 |
|
OneToMany | |||
fruit fly (Drosophila melanogaster) |
Insecta | CG6498 34 |
|
OneToMany | |
worm (Caenorhabditis elegans) |
Secernentea | kin-4 34 |
|
OneToMany | |
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | KIN82 34 |
|
ManyToMany | |
FPK1 34 |
|
ManyToMany | |||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany |
- Species where no ortholog for MAST1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for MAST1 Gene
(27) SIMAP similar genes for MAST1 Gene using alignment to 4 proteins:
Variants for MAST1 Gene
SNP ID | Clin | Chr 19 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
VAR_040768 | A metastatic melanoma sample | p.Ala269Thr | |||
VAR_040769 | An ovarian serous carcinoma sample | p.His1240Tyr | |||
rs878853165 | likely-pathogenic, not provided | 12,843,558(+) | C/T | coding_sequence_variant, genic_upstream_transcript_variant, missense_variant | |
rs1000101137 | -- | 12,855,013(+) | T/G | genic_upstream_transcript_variant, intron_variant | |
rs1000101908 | -- | 12,873,257(+) | G/T | intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
esv2663622 | CNV | deletion | 23128226 |
esv3643714 | CNV | loss | 21293372 |
nsv1153883 | CNV | duplication | 26484159 |
nsv2420 | CNV | insertion | 18451855 |
nsv953977 | CNV | deletion | 24416366 |
Additional Variant Information for MAST1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAST1 Gene
Disorders for MAST1 Gene
Additional Disease Information for MAST1
No disorders were found for MAST1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MAST1 Gene
Publications for MAST1 Gene
- The DNA sequence and biology of human chromosome 19. (PMID: 15057824) Grimwood J … Lucas SM (Nature 2004) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
- Sast124, a novel splice variant of syntrophin-associated serine/threonine kinase (SAST), is specifically localized in the restricted brain regions. (PMID: 12614677) Yano R … Hashikawa T (Neuroscience 2003) 3 22 58
- Interactions between beta 2-syntrophin and a family of microtubule-associated serine/threonine kinases. (PMID: 10404183) Lumeng C … Chamberlain JS (Nature neuroscience 1999) 3 22 58
- Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10231032) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 3 4 58
Products for MAST1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for MAST1
- Search Origene for MassSpec and Protein Over-expression Lysates for MAST1
- Origene Custom Protein Services for MAST1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for MAST1
- Browse OriGene Inhibitory RNA Products For MAST1
- OriGene qPCR primer pairs for MAST1
- OriGene CRISPR knockouts for MAST1
- OriGene ORF clones in human for MAST1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MAST1
- GenScript: Next-day shipping of latest version cDNA ORF clones for MAST1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for MAST1
- GenScript Custom Assay Services for MAST1
- GenScript Custom overexpressing Cell Line Services for MAST1
- GenScript: Design CRISPR guide RNA sequences for MAST1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for MAST1
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for MAST1
- Novus Biologicals lysates and proteins for MAST1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for MAST1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAST1
- VectorBuilder custom plasmid, inducible vectors for MAST1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAST1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for MAST1
- antibodies-online: Search results for 14 available MAST1 Antibodies ranked by validation data
- Compare Top MAST1 Antibodies
- antibodies-online: Search results for 3 available MAST1 Elisa Kits ranked by validation data
- Compare Top MAST1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for available MAST1 related products ranked by validation data
- GeneTex MAST1 antibody for MAST1
- Search GeneTex for Proteins for MAST1
- ViGene Biosciences adenoviral particle packaged cDNA for MAST1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for MAST1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for MAST1 gene
- Search ViGene Biosciences for MAST1
- Santa Cruz Biotechnology (SCBT) Antibodies for MAST1
- Search Santa Cruz Biotechnology (SCBT) for MAST1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MAST1
- Horizon Cell Lines for MAST1
- genomics-online: cdna clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- orf clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- genomics-online: gRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- genomics-online: primer clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
- genomics-online: shRNA clones - Search results for 74 available MAST1 gene related products
- Overview of 74 available MAST1 gene related products
Sources for MAST1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew