Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAPK7 Gene

Aliases for MAPK7 Gene

  • Mitogen-Activated Protein Kinase 7 2 3 5
  • Extracellular-Signal-Regulated Kinase 5 2 3
  • Big MAP Kinase 1 3 4
  • MAP Kinase 7 3 4
  • EC 2.7.11.24 4 58
  • BMK1 Kinase 2 3
  • MAPK 7 3 4
  • PRKM7 3 4
  • BMK-1 3 4
  • ERK-5 3 4
  • BMK1 3 4
  • ERK5 3 4
  • Extracellular Signal-Regulated Kinase 5 4
  • EC 2.7.11 58
  • ERK4 3

External Ids for MAPK7 Gene

Previous HGNC Symbols for MAPK7 Gene

  • PRKM7

Previous GeneCards Identifiers for MAPK7 Gene

  • GC17P019413
  • GC17P020752
  • GC17P019185
  • GC17P019443
  • GC17P019221
  • GC17P018660
  • GC17P019281

Summaries for MAPK7 Gene

Entrez Gene Summary for MAPK7 Gene

  • The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

GeneCards Summary for MAPK7 Gene

MAPK7 (Mitogen-Activated Protein Kinase 7) is a Protein Coding gene. Diseases associated with MAPK7 include Caroli Disease and Noma. Among its related pathways are Arrhythmogenic right ventricular cardiomyopathy (ARVC) and Activated TLR4 signalling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is NLK.

UniProtKB/Swiss-Prot for MAPK7 Gene

  • Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways. Phosphorylates SGK1 at Ser-78 and this is required for growth factor-induced cell cycle progression. Involved in the regulation of p53/TP53 by disrupting the PML-MDM2 interaction.

Tocris Summary for MAPK7 Gene

  • Extracellular signal-regulated kinases are a group of mitogen-activated protein kinases (MAPK) that mediate intracellular signaling. ERK1 and ERK2 (MAPK3 and MAPK1) transduce signals from growth factors and phorbol esters. They are expressed in all tissues, at varying levels.

Gene Wiki entry for MAPK7 Gene

Additional gene information for MAPK7 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAPK7 Gene

Genomics for MAPK7 Gene

Regulatory Elements for MAPK7 Gene

Enhancers for MAPK7 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17H018410 1.2 ENCODE dbSUPER 60.3 -966.5 -966472 1 SIN3A GLI4 ZNF2 ZNF302 KLF7 SP3 YY2 REST TSHZ1 ZNF488 FOXO3B MAPK7 DRG2 SMCR8 ZNF286B ENSG00000264885 SMCR5 SHMT1 ENSG00000262202 NOS2P2
GH17H019254 0.9 dbSUPER 65.3 -122.8 -122764 1 ZNF493 ZFP64 ZNF121 ZNF302 KLF7 ZNF202 SP3 ZC3H11A REST ZNF623 ENSG00000264885 FOXO3B MAPK7 FAM106A SMCR8 CCDC144B ZNF286B ENSG00000262202 ENSG00000273018 ENSG00000264932
GH17H018780 1.1 ENCODE 43.1 -596.5 -596506 1 HDGF PKNOX1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 ZBTB7B YY1 ZNF302 TVP23B MAPK7 FOXO3B SMCR8 DRG2 ZNF286B LOC100419436 ENSG00000264885 ENSG00000262202 TOP3A
GH17H019111 1.2 ENCODE dbSUPER 37.8 -265.9 -265911 1 HNRNPUL1 PKNOX1 ARNT ZNF121 GLIS2 ATF7 SNIP1 GLIS1 NBN CTCF MAPK7 SMCR8 FOXO3B ENSG00000262202 AKAP10 TOP3A LOC102724624 FLII FAM106A SNORD3D
GH17H019506 1.4 Ensembl ENCODE 23.3 +130.1 130116 2 ARID4B SIN3A ZNF2 YY1 SLC30A9 ZNF143 ZNF207 FOS DEK SP3 UPF3AP2 TVP23B ENSG00000264885 ZNF286B MAPK7 FAM106A PRPSAP2 ENSG00000264932 ENSG00000273018 USP32P2
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MAPK7 on UCSC Golden Path with GeneCards custom track

Promoters for MAPK7 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000092225 579 2201 HDGF PKNOX1 MLX ARID4B SIN3A FEZF1 DMAP1 ZNF2 ZBTB7B YY1

Transcription factor binding sites by QIAGEN in the MAPK7 gene promoter:

Genomic Location for MAPK7 Gene

Chromosome:
17
Start:
19,377,721 bp from pter
End:
19,383,544 bp from pter
Size:
5,824 bases
Orientation:
Plus strand

Genomic View for MAPK7 Gene

Genes around MAPK7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAPK7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAPK7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAPK7 Gene

Proteins for MAPK7 Gene

  • Protein details for MAPK7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13164-MK07_HUMAN
    Recommended name:
    Mitogen-activated protein kinase 7
    Protein Accession:
    Q13164
    Secondary Accessions:
    • Q16634
    • Q59F50
    • Q6QLU7
    • Q7L4P4
    • Q969G1
    • Q96G51

    Protein attributes for MAPK7 Gene

    Size:
    816 amino acids
    Molecular mass:
    88386 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with MAP2K5. Forms oligomers (By similarity). Interacts with MEF2A, MEF2C and MEF2D; the interaction phosphorylates the MEF2s and enhances transcriptional activity of MEF2A, MEF2C but not MEF2D (By similarity). Interacts with SGK1. Preferentially interacts with PML isoform PML-4 but shows interaction also with its other isoforms: isoform PML-1, isoform PML-2, isoform PML-3 and isoform PML-6. Interacts (via N-terminal half) with HSP90AB1-CDC37 chaperone complex in resting cells; the interaction is MAP2K5-independent and prevents MAPK7 from ubiquitination and proteasomal degradation (PubMed:23428871).
    SequenceCaution:
    • Sequence=AAA81381.1; Type=Frameshift; Positions=19, 32; Evidence={ECO:0000305}; Sequence=BAD92848.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for MAPK7 Gene

    Alternative splice isoforms for MAPK7 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MAPK7 Gene

Selected DME Specific Peptides for MAPK7 Gene

Q13164:
  • YVATRWYR
  • YHDPDDEP
  • VIHRDLKPSN
  • DPLAGLVLSDNDRSLLERWTRMA
  • FLYQLLRGLK
  • TEYVATRWYRAPE
  • QLLRGLKY
  • GAISDNTKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPV
  • KILKHFKH
  • VIHRDLK
  • TRWYRAPE
  • NIIAIKDI
  • LKIGDFG
  • VLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGA

Post-translational modifications for MAPK7 Gene

  • Dually phosphorylated on Thr-219 and Tyr-221, which activates the enzyme (By similarity). Autophosphorylated in vitro on threonine and tyrosine residues when the C-terminal part of the kinase, which could have a regulatory role, is absent.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for MAPK7 (ERK5)
  • Abcam antibodies for MAPK7
  • Cloud-Clone Corp. Antibodies for MAPK7

Domains & Families for MAPK7 Gene

Gene Families for MAPK7 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for MAPK7 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q13164

UniProtKB/Swiss-Prot:

MK07_HUMAN :
  • The second proline-rich region may interact with actin targeting the kinase to a specific location in the cell.
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Domain:
  • The second proline-rich region may interact with actin targeting the kinase to a specific location in the cell.
  • The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
genes like me logo Genes that share domains with MAPK7: view

Function for MAPK7 Gene

Molecular function for MAPK7 Gene

GENATLAS Biochemistry:
mitogen-activated protein kinase 7,extracellular signal regulated kinase 5 with three alternatively spliced isoforms,abundantly expressed in heart,placenta,kidney,skeletal muscle,involved in signal transduction,deleted in Smith-Magenis syndrome,involved in the transcriptional activation of factors modulating expression of genes required for cell proliferation
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by tyrosine and threonine phosphorylation (By similarity). Activated in response to hyperosmolarity, hydrogen peroxide, and epidermal growth factor (EGF).
UniProtKB/Swiss-Prot Function:
Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways. Phosphorylates SGK1 at Ser-78 and this is required for growth factor-induced cell cycle progression. Involved in the regulation of p53/TP53 by disrupting the PML-MDM2 interaction.

Enzyme Numbers (IUBMB) for MAPK7 Gene

Phenotypes From GWAS Catalog for MAPK7 Gene

Gene Ontology (GO) - Molecular Function for MAPK7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS --
GO:0004707 MAP kinase activity TAS,IBA --
GO:0005515 protein binding IPI 7759517
genes like me logo Genes that share ontologies with MAPK7: view
genes like me logo Genes that share phenotypes with MAPK7: view

Animal Models for MAPK7 Gene

MGI Knock Outs for MAPK7:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAPK7
  • Applied Biological Materials Clones for MAPK7
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK7 Gene

Localization for MAPK7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAPK7 Gene

Cytoplasm. Nucleus. Nucleus, PML body. Note=Translocates to the nucleus upon activation.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAPK7 gene
Compartment Confidence
nucleus 5
cytosol 5
extracellular 2
plasma membrane 1
cytoskeleton 1
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (4)
  • Nucleus (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for MAPK7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005634 nucleus IDA,IEA 18588859
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IDA,IEA 22869143
GO:0005829 cytosol IDA,TAS --
genes like me logo Genes that share ontologies with MAPK7: view

Pathways & Interactions for MAPK7 Gene

SuperPathways for MAPK7 Gene

genes like me logo Genes that share pathways with MAPK7: view

SIGNOR curated interactions for MAPK7 Gene

Activates:
Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for MAPK7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IEA --
GO:0006468 protein phosphorylation IEA --
GO:0007049 cell cycle IEA --
GO:0007165 signal transduction TAS 7646528
GO:0007411 axon guidance TAS --
genes like me logo Genes that share ontologies with MAPK7: view

Drugs & Compounds for MAPK7 Gene

(13) Drugs for MAPK7 Gene - From: ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Icosapent Approved Nutra Endogenous polyunsaturated fatty acid; stimulates ERK1/2 phosphorylation 0
XMD8-92 Pharma BMK1/ERK5 inhibitor,highly selective, ERK5/BMK1 inhibitor 0
DEL-22379 Pharma inhibitor of the dimerization of ERK 0
VX-11e Pharma ERK inhibitor 0
XMD17-109 Pharma ERK-5 inhibitor 0

(10) Additional Compounds for MAPK7 Gene - From: Novoseek, HMDB, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
ERK5-IN-1
1435488-37-1
TCS ERK 11e
896720-20-0

(5) Tocris Compounds for MAPK7 Gene

Compound Action Cas Number
Eicosapentaenoic Acid Endogenous polyunsaturated fatty acid; stimulates ERK1/2 phosphorylation 10417-94-4
ERK5-IN-1 Potent and selective ERK5 inhibitor 1435488-37-1
FR 180204 Selective ERK inhibitor 865362-74-9
TCS ERK 11e Potent and selective ERK2 inhibitor 896720-20-0
XMD 8-92 ERK5/BMK1 inhibitor 1234480-50-2

(4) ApexBio Compounds for MAPK7 Gene

Compound Action Cas Number
DEL-22379 inhibitor of the dimerization of ERK 181223-80-3
VX-11e ERK inhibitor 896720-20-0
XMD17-109 ERK-5 inhibitor 1435488-37-1
XMD8-92 BMK1/ERK5 inhibitor,highly selective 1234480-50-2
genes like me logo Genes that share compounds with MAPK7: view

Drug Products

Transcripts for MAPK7 Gene

Unigene Clusters for MAPK7 Gene

Mitogen-activated protein kinase 7:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MAPK7
  • Applied Biological Materials Clones for MAPK7
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for MAPK7 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b · 6c ^ 7a · 7b · 7c ^ 8a · 8b · 8c · 8d ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b
SP1: - - - - - - - - - -
SP2: - - - - - - - -
SP3: - - - - - - - -
SP4: - - - - - -
SP5: - - - - -
SP6: - - - - - - -
SP7: - - - - - - - - - - - - - - - - - - -
SP8: - - - - -
SP9: -
SP10:
SP11: - - - - - - - - - - - -
SP12:
SP13:
SP14:

Relevant External Links for MAPK7 Gene

GeneLoc Exon Structure for
MAPK7
ECgene alternative splicing isoforms for
MAPK7

Expression for MAPK7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAPK7 Gene

Protein differential expression in normal tissues from HIPED for MAPK7 Gene

This gene is overexpressed in Plasma (32.4) and Fetal ovary (8.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for MAPK7 Gene



Protein tissue co-expression partners for MAPK7 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of MAPK7 Gene:

MAPK7

SOURCE GeneReport for Unigene cluster for MAPK7 Gene:

Hs.150136

mRNA Expression by UniProt/SwissProt for MAPK7 Gene:

Q13164-MK07_HUMAN
Tissue specificity: Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.

Evidence on tissue expression from TISSUES for MAPK7 Gene

  • Nervous system(4.7)
  • Muscle(4.5)
  • Pancreas(4.2)
  • Spleen(4.2)
  • Heart(2.4)
genes like me logo Genes that share expression patterns with MAPK7: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAPK7 Gene

Orthologs for MAPK7 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for MAPK7 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAPK7 33 34
  • 98.97 (n)
dog
(Canis familiaris)
Mammalia MAPK7 33 34
  • 90.72 (n)
cow
(Bos Taurus)
Mammalia MAPK7 33 34
  • 89.62 (n)
mouse
(Mus musculus)
Mammalia Mapk7 33 16 34
  • 85.81 (n)
rat
(Rattus norvegicus)
Mammalia Mapk7 33
  • 85.14 (n)
oppossum
(Monodelphis domestica)
Mammalia MAPK7 34
  • 85 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 39 (a)
ManyToMany
lizard
(Anolis carolinensis)
Reptilia MAPK7 34
  • 64 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mapk7 33
  • 67.75 (n)
zebrafish
(Danio rerio)
Actinopterygii mapk7 33 34
  • 65.83 (n)
fruit fly
(Drosophila melanogaster)
Insecta p38c 35
  • 39 (a)
worm
(Caenorhabditis elegans)
Secernentea F09C12.2 35
  • 40 (a)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AER232C 33
  • 54.42 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0B11902g 33
  • 52.56 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SLT2 33
  • 50.9 (n)
FUS3 34
  • 47 (a)
ManyToMany
KSS1 34
  • 47 (a)
ManyToMany
KDX1 36
thale cress
(Arabidopsis thaliana)
eudicotyledons MPK4 33
  • 55.83 (n)
soybean
(Glycine max)
eudicotyledons Gma.3675 33
rice
(Oryza sativa)
Liliopsida Os10g0533600 33
  • 57.22 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.5234 33
wheat
(Triticum aestivum)
Liliopsida Ta.7205 33
bread mold
(Neurospora crassa)
Ascomycetes NCU11376 33
  • 58.7 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes pmk1 33
  • 51.04 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6704 34
  • 36 (a)
OneToOne
Species where no ortholog for MAPK7 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for MAPK7 Gene

ENSEMBL:
Gene Tree for MAPK7 (if available)
TreeFam:
Gene Tree for MAPK7 (if available)

Paralogs for MAPK7 Gene

Variants for MAPK7 Gene

Sequence variations from dbSNP and Humsavar for MAPK7 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1000223798 -- 19,377,717(+) TGGGT(C/T)GGGAC intron-variant, upstream-variant-2KB
rs1000495556 -- 19,376,658(+) CCGGG(A/C)TTGAT intron-variant, upstream-variant-2KB
rs1000777898 -- 19,376,243(+) TATAA(A/C)CCAAA intron-variant, upstream-variant-2KB
rs1001125878 -- 19,382,331(+) CTGCC(A/T)GGCTC reference, synonymous-codon
rs1001271279 -- 19,380,129(+) GTGTA(C/G)AGATG intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for MAPK7 Gene

Variant ID Type Subtype PubMed ID
esv3582561 CNV loss 25503493
nsv1061317 CNV gain 25217958
nsv953845 CNV deletion 24416366

Variation tolerance for MAPK7 Gene

Residual Variation Intolerance Score: 4.02% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.40; 42.42% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MAPK7 Gene

Human Gene Mutation Database (HGMD)
MAPK7
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAPK7

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK7 Gene

Disorders for MAPK7 Gene

MalaCards: The human disease database

(2) MalaCards diseases for MAPK7 Gene - From: HGMD and GeneCards

Disorder Aliases PubMed IDs
caroli disease
  • caroli disease isolated
noma
  • cancrum oris
- elite association - COSMIC cancer census association via MalaCards
Search MAPK7 in MalaCards View complete list of genes associated with diseases

Relevant External Links for MAPK7

Genetic Association Database (GAD)
MAPK7
Human Genome Epidemiology (HuGE) Navigator
MAPK7
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MAPK7
genes like me logo Genes that share disorders with MAPK7: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK7 Gene

Publications for MAPK7 Gene

  1. Components of a new human protein kinase signal transduction pathway. (PMID: 7759517) Zhou G … Dixon JE (The Journal of biological chemistry 1995) 2 3 4 22 60
  2. Identification and characterization of mErk5-T, a novel Erk5/Bmk1 splice variant. (PMID: 15716121) McCaw BJ … Guy GR (Gene 2005) 3 4 22 60
  3. Granulocyte colony-stimulating factor induces ERK5 activation, which is differentially regulated by protein-tyrosine kinases and protein kinase C. Regulation of cell proliferation and survival. (PMID: 11278431) Dong F … Larner AC (The Journal of biological chemistry 2001) 3 4 22 60
  4. Bmk1/Erk5 is required for cell proliferation induced by epidermal growth factor. (PMID: 9790194) Kato Y … Lee JD (Nature 1998) 3 4 22 60
  5. Primary structure of BMK1: a new mammalian map kinase. (PMID: 7646528) Lee JD … Han J (Biochemical and biophysical research communications 1995) 3 4 22 60

Products for MAPK7 Gene

  • Addgene plasmids for MAPK7

Sources for MAPK7 Gene

Content
Loading form....