Aliases for MAPK6 Gene
Aliases for MAPK6 Gene
External Ids for MAPK6 Gene
- HGNC: 6879
- Entrez Gene: 5597
- Ensembl: ENSG00000069956
- OMIM: 602904
- UniProtKB: Q16659
Previous HGNC Symbols for MAPK6 Gene
- PRKM6
Previous GeneCards Identifiers for MAPK6 Gene
- GC15P047869
- GC15P045358
- GC15P049890
- GC15P050027
- GC15P050098
- GC15P052311
- GC15P029169
Summaries for MAPK6 Gene
-
The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq, Jul 2008]
GeneCards Summary for MAPK6 Gene
MAPK6 (Mitogen-Activated Protein Kinase 6) is a Protein Coding gene. Diseases associated with MAPK6 include Pulmonary Immaturity. Among its related pathways are VEGF Signaling Pathway and IL-2 Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAPK4.
UniProtKB/Swiss-Prot for MAPK6 Gene
-
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAPK6 Gene
Genomics for MAPK6 Gene
Regulatory Elements for MAPK6 Gene
Enhancers for MAPK6 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around MAPK6 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for MAPK6 Gene
- Chromosome:
- 15
- Start:
- 51,952,106 bp from pter
- End:
- 52,067,372 bp from pter
- Size:
- 115,267 bases
- Orientation:
- Plus strand
Genomic View for MAPK6 Gene
Genes around MAPK6 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 15q21.2 by Ensembl
- 15q21.2 by Entrez Gene
- 15q21.2 by HGNC
MAPK6 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MAPK6 Gene
Proteins for MAPK6 Gene
-
Protein details for MAPK6 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q16659-MK06_HUMAN
- Recommended name:
- Mitogen-activated protein kinase 6
- Protein Accession:
- Q16659
- B2R945
- B5BU65
- Q68DH4
- Q8IYN8
Protein attributes for MAPK6 Gene
- Size:
- 721 amino acids
- Molecular mass:
- 82681 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Heterodimer with ERK4/MAPK4. Interacts with (via FRIEDE motif) MAPKAPK5 (By similarity). Interacts with UBE3A; this interaction may be indirect and mediated by HERC2, possibly via HERC2 interaction with NEURL4.
Protein Expression for MAPK6 Gene
Selected DME Specific Peptides for MAPK6 Gene
- Q16659:
-
- DPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDT
- GLKYIHSA
- HSHIYNWERYH
- GCIFAEM
- LSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCI
- YIVQEYMETDLA
- LFAGAHELEQMQLIL
- HSANVLHRDL
- LKYIHSA
- QLLRGLKY
- RVAIKKI
- VLHRDLK
- NGLVKAQIALEEASQQL
- TEDLVLKIGDFGLARI
- KHALREIKIIRRLDHDNIVKV
- LKIGDFG
- VDKLNDLNSSVSQ
- PMDRLTAE
Post-translational modifications for MAPK6 Gene
- Phosphorylated at Ser-189 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
- Ubiquitination at Met-1 leads to degradation by the proteasome pathway.
- Ubiquitination at Lys 447, Lys 471, Lys 480, Lys 517, Lys 563, Lys 631, Lys 672, Lys 691, and Lys 703
- Modification sites at PhosphoSitePlus
Other Protein References for MAPK6 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for MAPK6
- R&D Systems Antibodies for MAPK6 (ERK3)
- Cell Signaling Technology (CST) Antibodies for MAPK6 (ERK3)
-
Custom Antibody ServicesOriGene Antibodies for MAPK6
- Novus Biologicals Antibodies for MAPK6
- Invitrogen Antibodies for MAPK6
- antibodies-online Antibodies for MAPK6: See all 130
- GeneTex MAPK6 antibody for MAPK6
-
Santa Cruz Biotechnology (SCBT) Antibodies for MAPK6
Protein Products
-
OriGene Purified Proteins for MAPK6
- Search Origene for MassSpec and Protein Over-expression Lysates for MAPK6
- Origene Custom Protein Services for MAPK6
- antibodies-online Proteins for MAPK6: See all 10
- Search antibodies-online for peptides
- Search GeneTex for Proteins for MAPK6
Assay Products
- antibodies-online Kits for MAPK6: See all 11
Domains & Families for MAPK6 Gene
Gene Families for MAPK6 Gene
Protein Domains for MAPK6 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for MAPK6 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q16659UniProtKB/Swiss-Prot:
MK06_HUMAN :- In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
- Domain:
-
- In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
- Contains 1 protein kinase domain.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Function for MAPK6 Gene
Molecular function for MAPK6 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activated by phosphorylation at Ser-189.
- UniProtKB/Swiss-Prot Function:
- Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
Enzyme Numbers (IUBMB) for MAPK6 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | TAS | -- |
| GO:0004707 | MAP kinase activity | ISS | -- |
| GO:0005515 | protein binding | IPI | 20936779 |
Phenotypes for MAPK6 Gene
- MGI mutant phenotypes for MAPK6:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for MAPK6:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Decreased hepcidin::fluc mRNA expression
- shRNA abundance <= 50%
- Resistant to vaccinia virus (VACV-A4L) infection
- Increased transferrin (TF) endocytosis
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased cell migration
- Increased cell viability after pRB stimulation
- Increased mitotic index
- Increased cell migration
Animal Models for MAPK6 Gene
- MGI Knock Outs for MAPK6:
-
- Mapk6 tm1Melo
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAPK6
-
-
ViGene Biosciences lentiviral particle packaged cDNA for MAPK6 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAPK6 gene
- Search ViGene Biosciences for MAPK6
CRISPR Products
-
OriGene CRISPR knockouts for MAPK6
- GenScript: Design CRISPR guide RNA sequences for MAPK6
miRNA for MAPK6 Gene
- miRTarBase miRNAs that target MAPK6
-
- hsa-mir-128-3p (MIRT021894)
- hsa-mir-100-5p (MIRT048392)
- hsa-mir-99a-5p (MIRT048608)
- hsa-mir-15a-5p (MIRT051334)
- hsa-mir-577 (MIRT193058)
- hsa-mir-26a-5p (MIRT193070)
- hsa-mir-26b-5p (MIRT193071)
- hsa-mir-1297 (MIRT193073)
- hsa-mir-3662 (MIRT193075)
- hsa-mir-4465 (MIRT193076)
- hsa-mir-511-3p (MIRT193093)
- hsa-mir-3177-5p (MIRT193094)
- hsa-let-7a-5p (MIRT193097)
- hsa-let-7b-5p (MIRT193098)
- hsa-let-7c-5p (MIRT193099)
- hsa-let-7d-5p (MIRT193100)
- hsa-let-7e-5p (MIRT193101)
- hsa-let-7f-5p (MIRT193102)
- hsa-mir-98-5p (MIRT193103)
- hsa-let-7g-5p (MIRT193104)
- hsa-let-7i-5p (MIRT193105)
- hsa-mir-3935 (MIRT193110)
- hsa-mir-4458 (MIRT193112)
- hsa-mir-4500 (MIRT193113)
- hsa-mir-4643 (MIRT193114)
- hsa-mir-10a-3p (MIRT281381)
- hsa-mir-363-5p (MIRT281386)
- hsa-mir-1293 (MIRT281393)
- hsa-mir-3115 (MIRT281394)
- hsa-mir-4307 (MIRT281397)
- hsa-mir-4483 (MIRT281400)
- hsa-mir-6745 (MIRT281402)
- hsa-mir-6756-5p (MIRT281403)
- hsa-mir-6766-5p (MIRT281404)
- hsa-mir-4304 (MIRT385976)
- hsa-mir-302a-5p (MIRT448682)
- hsa-mir-3920 (MIRT448683)
- hsa-mir-29a-5p (MIRT448684)
- hsa-mir-5697 (MIRT448685)
- hsa-mir-4776-3p (MIRT501968)
- hsa-mir-4715-3p (MIRT501969)
- hsa-mir-3064-3p (MIRT501970)
- hsa-mir-19b-2-5p (MIRT501971)
- hsa-mir-19b-1-5p (MIRT501972)
- hsa-mir-19a-5p (MIRT501973)
- hsa-mir-2052 (MIRT501974)
- hsa-mir-190a-3p (MIRT542883)
- hsa-mir-8076 (MIRT542884)
- hsa-mir-5011-5p (MIRT542885)
- hsa-mir-8485 (MIRT542886)
- hsa-mir-664b-3p (MIRT556260)
- hsa-mir-579-3p (MIRT556261)
- hsa-mir-5696 (MIRT556262)
- hsa-mir-4724-3p (MIRT556263)
- hsa-mir-202-3p (MIRT556264)
- hsa-mir-153-5p (MIRT556265)
- hsa-mir-1250-3p (MIRT556266)
- hsa-mir-664a-3p (MIRT556267)
- hsa-mir-6813-3p (MIRT556268)
- hsa-mir-3200-3p (MIRT556269)
- hsa-mir-4789-5p (MIRT611992)
- hsa-mir-3941 (MIRT611993)
- hsa-mir-603 (MIRT611994)
- hsa-mir-362-3p (MIRT611995)
- hsa-mir-329-3p (MIRT611996)
- hsa-mir-6787-3p (MIRT656449)
- hsa-mir-3942-3p (MIRT656450)
- hsa-mir-499b-5p (MIRT656451)
- hsa-mir-4494 (MIRT656452)
- hsa-mir-8087 (MIRT656453)
- hsa-mir-7161-5p (MIRT656454)
- hsa-mir-548u (MIRT656455)
- hsa-mir-1277-5p (MIRT708054)
- hsa-mir-1252-3p (MIRT708055)
- hsa-mir-3646 (MIRT708056)
miRNA Products
- Search ViGene Biosciences for MAPK6
Clone Products
- Sino Biological Human cDNA Clone for MAPK6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for MAPK6
- VectorBuilder custom plasmid, inducible vectors for MAPK6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAPK6
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for MAPK6
-
ViGene Biosciences adenoviral particle packaged cDNA for MAPK6 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for MAPK6 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MAPK6 gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK6 Gene
Localization for MAPK6 Gene
Subcellular locations from UniProtKB/Swiss-Prot for MAPK6 Gene
- Cytoplasm. Nucleus. Note=Translocates to the cytoplasm following interaction with MAPKAPK5. {ECO:0000250}.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| cytoskeleton | 3 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | ISS | -- |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005737 | cytoplasm | ISS,IDA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0032156 | septin cytoskeleton | IEA | -- |
Pathways & Interactions for MAPK6 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | IL-2 Pathway |
.59
|
.48
.36
|
| 2 | GPCR Pathway |
.73
.62
|
|
| 3 | VEGF Signaling Pathway | ||
| 4 | Apoptotic Pathways in Synovial Fibroblasts |
.60
|
.57
|
| 5 | TNF Signaling (sino) | ||
Pathways by source for MAPK6 Gene
13 Sino Biological pathways for MAPK6 Gene
1 Cell Signaling Technology pathway for MAPK6 Gene
6 BioSystems pathways for MAPK6 Gene
3 Reactome pathways for MAPK6 Gene
1 PharmGKB pathway for MAPK6 Gene
2 Tocris pathways for MAPK6 Gene
55 Qiagen pathways for MAPK6 Gene
Interacting Proteins for MAPK6 Gene
Selected Interacting proteins:
Q16659-MK06_HUMAN
ENSP00000261845
for MAPK6 Gene via
MINT
STRING
UniProtKB
IID
SIGNOR curated interactions for MAPK6 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000165 | MAPK cascade | IEA | -- |
| GO:0006468 | protein phosphorylation | ISS,TAS | -- |
| GO:0007049 | cell cycle | IEA | -- |
| GO:0007165 | signal transduction | TAS | 2032290 |
| GO:0016310 | phosphorylation | IEA | -- |
Drugs & Compounds for MAPK6 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
(1) ApexBio Compounds for MAPK6 Gene
| Compound | Action | Cas Number |
|---|---|---|
| FR 180204 | ERK inhibitor | 865362-74-9 |
Drug Products
- ApexBio compounds for MAPK6
Transcripts for MAPK6 Gene
mRNA/cDNA for MAPK6 Gene
- (5) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (264) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for MAPK6 Gene
CRISPR Products
-
OriGene CRISPR knockouts for MAPK6
- GenScript: Design CRISPR guide RNA sequences for MAPK6
miRNA Products
- Search ViGene Biosciences for MAPK6
Clone Products
- Sino Biological Human cDNA Clone for MAPK6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for MAPK6
- VectorBuilder custom plasmid, inducible vectors for MAPK6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAPK6
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | · | 5c | · | 5d | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||
| SP3: | - | - | |||||||||||||||||||||
| SP4: | - |
Expression for MAPK6 Gene
This gene is overexpressed in Brain (37.6), Monocytes (18.1), and Heart (13.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAPK6 Gene
NURSA nuclear receptor signaling pathways regulating expression of MAPK6 Gene:
MAPK6SOURCE GeneReport for Unigene cluster for MAPK6 Gene:
Hs.411847mRNA Expression by UniProt/SwissProt for MAPK6 Gene:
Q16659-MK06_HUMAN
Tissue specificity:
Highest expression in the skeletal muscle, followed by the brain. Also found in heart, placenta, lung, liver, pancreas, kidney and skin fibroblasts.
Primer Products
-
OriGene qPCR primer pairs for MAPK6
-
OriGene qPCR primer pairs and template standards for MAPK6
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for MAPK6 Gene
Orthologs for MAPK6 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | MAPK6 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | MAPK6 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | -- 35 |
|
OneToMany | |
| -- 35 |
|
OneToMany | |||
| -- 35 |
|
OneToMany | |||
| cow (Bos Taurus) |
Mammalia | MAPK6 34 35 |
|
||
| mouse (Mus musculus) |
Mammalia | Mapk6 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Mapk6 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | MAPK6 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | MAPK6 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | MAPK6 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | mapk6 34 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.23931 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | mapk6 34 35 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | FUS3 35 |
|
ManyToMany | |
| KSS1 35 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.7149 35 |
|
OneToMany |
- Species where no ortholog for MAPK6 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for MAPK6 Gene
(9) SIMAP similar genes for MAPK6 Gene using alignment to 1 proteins:
Pseudogenes.org Pseudogenes for MAPK6 Gene
Variants for MAPK6 Gene
| SNP ID | Clin | Chr 15 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs10152132 | -- | 52,005,332(+) | ctatc(A/C)tgacc | intron-variant | |
| rs10152141 | -- | 52,010,715(+) | gattt(C/T)accat | intron-variant | |
| rs10152475 | -- | 52,049,210(+) | TAGAC(A/T)TTGGT | intron-variant | |
| rs1049603 | -- | 52,058,675(+) | ATCTA(G/T)TCCTG | reference, missense | |
| rs1049605 | -- | 52,058,698(+) | AAGAT(C/T)GTCAG | reference, missense |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv984071 | CNV | duplication | 23825009 |
| nsv984070 | CNV | duplication | 23825009 |
| nsv471244 | CNV | gain | 18288195 |
| nsv1536 | CNV | deletion | 18451855 |
| nsv1138369 | CNV | deletion | 24896259 |
| nsv1116073 | CNV | deletion | 24896259 |
| nsv1039841 | CNV | gain | 25217958 |
| esv2749691 | CNV | deletion | 23290073 |
| esv2351837 | CNV | deletion | 18987734 |
| dgv303e201 | CNV | deletion | 23290073 |
| dgv2595n100 | CNV | gain | 25217958 |
Residual Variation Intolerance Score:
9.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.72;
57.57% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for MAPK6 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- MAPK6
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK6 Gene
Disorders for MAPK6 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pulmonary immaturity |
|
|
Search MAPK6 in MalaCards
View complete list of genes associated with diseases
Relevant External Links for MAPK6
No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK6 Gene
Publications for MAPK6 Gene
- Primary structure, expression and chromosomal locus of a human homolog of rat ERK3. (PMID: 8875998) Meloche S. … Pellerin J. (Oncogene 1996) 2 3 4 22 64
- N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. (PMID: 15226418) Coulombe P. … Meloche S. (Mol. Cell. Biol. 2004) 3 4 22 64
- Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes. (PMID: 22645313) Martinez-Noel G. … Howley P.M. (Mol. Cell. Biol. 2012) 3 4 64
- Regulation of ERK3/MAPK6 expression by BRAF. (PMID: 16964379) Hoeflich K.P. … Seshagiri S. (Int. J. Oncol. 2006) 3 22 64
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
Products for MAPK6 Gene
- R&D Systems Antibodies for MAPK6 (ERK3)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for MAPK6
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for MAPK6
- Search Origene for MassSpec and Protein Over-expression Lysates for MAPK6
- Origene Custom Protein Services for MAPK6
- Origene siRNA, mouse_rna, shRNA, rat_shrna, and RNAi products in human, mouse, rat for MAPK6
- Browse OriGene Inhibitory RNA Products For MAPK6
- OriGene qPCR primer pairs and template standards for MAPK6
- OriGene qPCR primer pairs for MAPK6
- OriGene CRISPR knockouts for MAPK6
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For MAPK6
- GenScript: Next-day shipping cDNA clones in your preferred vector
- GenScript Custom Purified and Recombinant Proteins Services for MAPK6
- GenScript Custom Assay Services for MAPK6
- GenScript Custom overexpressing Cell Line Services for MAPK6
- GenScript: Design CRISPR guide RNA sequences for MAPK6
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for MAPK6
- Cell Signaling Technology (CST) Antibodies for MAPK6 (ERK3)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for MAPK6
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for MAPK6
- Novus Biologicals proteins and lysates for MAPK6
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Invitrogen Antibodies for MAPK6
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for MAPK6
- Addgene plasmids for MAPK6
- antibodies-online Antibodies for MAPK6: See all 130
- antibodies-online Kits for MAPK6: See all 11
- antibodies-online Proteins for MAPK6: See all 10
- Search antibodies-online for peptides
- GeneTex MAPK6 antibody for MAPK6
- Search GeneTex for Proteins for MAPK6
- ViGene Biosciences adenoviral particle packaged cDNA for MAPK6 gene
- ViGene Biosciences lentiviral particle packaged cDNA for MAPK6 gene
- ViGene Biosciences ready-to-package AAV shRNAs for MAPK6 gene
- Search ViGene Biosciences for MAPK6
- Santa Cruz Biotechnology (SCBT) Antibodies for MAPK6
- Search Santa Cruz Biotechnology (SCBT) for MAPK6 siRNA/shRNA
- Browse Santa Cruz Biotechnology (SCBT) for MAPK6 CRISPR
- Horizon Cell Lines for MAPK6
- Cyagen custom Knockout/knockin (KOKI) mouse models for MAPK6
- VectorBuilder custom plasmid, inducible vectors for MAPK6
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for MAPK6
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for MAPK6 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab