Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAPK4 Gene

Aliases for MAPK4 Gene

  • Mitogen-Activated Protein Kinase 4 2 3 5
  • Extracellular Signal-Regulated Kinase 4 3 4
  • MAP Kinase Isoform P63 3 4
  • EC 2.7.11.24 4 61
  • P63-MAPK 3 4
  • MAPK 4 3 4
  • PRKM4 3 4
  • ERK-4 3 4
  • ERK4 3 4
  • Erk3-Related 3
  • MAP Kinase 4 4
  • EC 2.7.11 61
  • P63MAPK 3

External Ids for MAPK4 Gene

Previous HGNC Symbols for MAPK4 Gene

  • PRKM4

Previous GeneCards Identifiers for MAPK4 Gene

  • GC18P048373
  • GC18P048125
  • GC18P047974
  • GC18P046441
  • GC18P046340
  • GC18P044941

Summaries for MAPK4 Gene

Entrez Gene Summary for MAPK4 Gene

  • Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus and phosphorylate nuclear targets. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

GeneCards Summary for MAPK4 Gene

MAPK4 (Mitogen-Activated Protein Kinase 4) is a Protein Coding gene. Diseases associated with MAPK4 include Pulmonary Immaturity. Among its related pathways are CCR5 Pathway in Macrophages and mTOR Pathway. GO annotations related to this gene include protein homodimerization activity and protein kinase activity. An important paralog of this gene is MAPK6.

UniProtKB/Swiss-Prot for MAPK4 Gene

  • Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK4/MAPK4 is phosphorylated at Ser-186 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK4/MAPK4. May promote entry in the cell cycle (By similarity).

Gene Wiki entry for MAPK4 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAPK4 Gene

Genomics for MAPK4 Gene

Regulatory Elements for MAPK4 Gene

Enhancers for MAPK4 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH18G050527 0.8 ENCODE 12.3 -31.1 -31145 2.7 ETV1 MAX RAD21 ZBTB40 GATA3 GATA2 POLR2A MAFK ZNF197 L3MBTL2 MAPK4 GC18P050479
GH18G050790 1 ENCODE dbSUPER 8.1 +234.1 234112 8.0 CTCF ZNF777 ZSCAN4 ZIC2 RAD21 YY1 ZFHX2 POLR2A SCRT2 HNF4G SMAD4 RPL17P46 MRO MAPK4 HNRNPA3P16 LOC105372116
GH18G050784 0.7 ENCODE 6.4 +224.8 224818 0.2 CTCF MAZ ZNF654 ZNF740 CEBPB REST ZNF2 RAD21 GLIS2 SMARCA4 MAPK4 HNRNPA3P16 LOC105372116
GH18G050747 0.9 ENCODE 4.7 +188.7 188729 1.9 FEZF1 GLIS2 KLF7 TSHZ1 ZNF488 ZNF610 ZSCAN16 GLIS1 PRDM4 SP7 MAPK4 LOC105372116 ENSG00000267713
GH18G050724 0.7 ENCODE 5.8 +166.5 166483 4.4 PKNOX1 FOXA2 CREB3L1 POLR2A EED ZNF26 SCRT2 IKZF2 CREM SCRT1 ELAC1 MAPK4 LOC105372116 ENSG00000267713
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MAPK4 on UCSC Golden Path with GeneCards custom track

Promoters for MAPK4 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000103312 -178 1001 CTCF BCOR MXI1 KLF1 SUZ12 ZMYM3 KLF17 RBBP5 ZIC2 ZNF664

Genomic Location for MAPK4 Gene

Chromosome:
18
Start:
50,560,078 bp from pter
End:
50,731,826 bp from pter
Size:
171,749 bases
Orientation:
Plus strand

Genomic View for MAPK4 Gene

Genes around MAPK4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAPK4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAPK4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAPK4 Gene

Proteins for MAPK4 Gene

  • Protein details for MAPK4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P31152-MK04_HUMAN
    Recommended name:
    Mitogen-activated protein kinase 4
    Protein Accession:
    P31152
    Secondary Accessions:
    • A1A4C4
    • Q0VG04

    Protein attributes for MAPK4 Gene

    Size:
    587 amino acids
    Molecular mass:
    65922 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer. Heterodimer with ERK3/MAPK6. Interacts with (via FRIEDE motif) MAPKAPK5 (By similarity).
    SequenceCaution:
    • Sequence=CAA42411.1; Type=Frameshift; Positions=Several; Evidence={ECO:0000305};

neXtProt entry for MAPK4 Gene

Selected DME Specific Peptides for MAPK4 Gene

P31152:
  • GCILAEM
  • GLKYIHSA
  • LSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCI
  • YIVQEYMETDLA
  • LFAGAHELEQMQLIL
  • DLKPANIFI
  • HSANVLHRDL
  • LKYIHSA
  • QLLRGLKY
  • VLHRDLK
  • TEDLVLKIGDFGLARI
  • KHALREIKIIRRLDHDNIVKV
  • LKIGDFG
  • PMDRLTAE

Post-translational modifications for MAPK4 Gene

  • Phosphorylated at Ser-186 by PAK1, PAK2 and PAK3 resulting in catalytic activation. Phosphorylated by MAPKAPK5 at other sites.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for MAPK4 Gene

Graphical View of Domain Structure for InterPro Entry

P31152

UniProtKB/Swiss-Prot:

MK04_HUMAN :
  • The FRIEDE motif is required for docking MAPKAPK5.
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Domain:
  • The FRIEDE motif is required for docking MAPKAPK5.
  • In contrast to classical MAPKs, the TXY motif within the activation loop is replaced by the SEG motif, whose phosphorylation activates the MAP kinases.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
genes like me logo Genes that share domains with MAPK4: view

Function for MAPK4 Gene

Molecular function for MAPK4 Gene

GENATLAS Biochemistry:
mitogen-activated protein kinase 4 (p63),expressed in heart muscle,brain
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation at Ser-186.
UniProtKB/Swiss-Prot Function:
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK4/MAPK4 is phosphorylated at Ser-186 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK4/MAPK4. May promote entry in the cell cycle (By similarity).

Enzyme Numbers (IUBMB) for MAPK4 Gene

Gene Ontology (GO) - Molecular Function for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS,IEA --
GO:0004707 MAP kinase activity IEA,IBA --
GO:0005515 protein binding IPI 22939624
genes like me logo Genes that share ontologies with MAPK4: view
genes like me logo Genes that share phenotypes with MAPK4: view

Animal Models for MAPK4 Gene

MGI Knock Outs for MAPK4:

Animal Model Products

  • Taconic Biosciences Mouse Models for MAPK4

CRISPR Products

miRNA for MAPK4 Gene

miRTarBase miRNAs that target MAPK4

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for MAPK4 Gene

Localization for MAPK4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAPK4 Gene

Cytoplasm. Nucleus. Note=Translocates to the cytoplasm following interaction with MAPKAPK5. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAPK4 gene
Compartment Confidence
nucleus 5
cytosol 5
cytoskeleton 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005634 nucleus IBA,ISS --
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IBA,ISS --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with MAPK4: view

Pathways & Interactions for MAPK4 Gene

genes like me logo Genes that share pathways with MAPK4: view

SIGNOR curated interactions for MAPK4 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for MAPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IEA --
GO:0006468 protein phosphorylation IEA,TAS 7969157
GO:0007049 cell cycle IEA --
GO:0010468 regulation of gene expression IBA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with MAPK4: view

Drugs & Compounds for MAPK4 Gene

(3) Drugs for MAPK4 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(1) Additional Compounds for MAPK4 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with MAPK4: view

Transcripts for MAPK4 Gene

Unigene Clusters for MAPK4 Gene

Mitogen-activated protein kinase 4:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for MAPK4 Gene

No ASD Table

Relevant External Links for MAPK4 Gene

GeneLoc Exon Structure for
MAPK4
ECgene alternative splicing isoforms for
MAPK4

Expression for MAPK4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAPK4 Gene

mRNA differential expression in normal tissues according to GTEx for MAPK4 Gene

This gene is overexpressed in Brain - Nucleus accumbens (basal ganglia) (x6.4), Brain - Caudate (basal ganglia) (x6.2), and Brain - Putamen (basal ganglia) (x5.7).

Protein differential expression in normal tissues from HIPED for MAPK4 Gene

This gene is overexpressed in Brain (39.5), Retina (13.7), and Heart (13.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAPK4 Gene



Protein tissue co-expression partners for MAPK4 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of MAPK4 Gene:

MAPK4

SOURCE GeneReport for Unigene cluster for MAPK4 Gene:

Hs.433728

mRNA Expression by UniProt/SwissProt for MAPK4 Gene:

P31152-MK04_HUMAN
Tissue specificity: High expression in heart and brain.

Evidence on tissue expression from TISSUES for MAPK4 Gene

  • Nervous system(4.8)
genes like me logo Genes that share expression patterns with MAPK4: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAPK4 Gene

Orthologs for MAPK4 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAPK4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAPK4 35 34
  • 99.43 (n)
OneToOne
cow
(Bos Taurus)
Mammalia MAPK4 35
  • 93 (a)
OneToOne
dog
(Canis familiaris)
Mammalia MAPK4 34 35
  • 90.95 (n)
mouse
(Mus musculus)
Mammalia Mapk4 35 16 34
  • 88.05 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Mapk4 34
  • 87.42 (n)
oppossum
(Monodelphis domestica)
Mammalia MAPK4 35
  • 85 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MAPK4 35
  • 84 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia MAPK4 35
  • 81 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100498202 34
  • 72.65 (n)
zebrafish
(Danio rerio)
Actinopterygii mapk4 34 35
  • 65.44 (n)
worm
(Caenorhabditis elegans)
Secernentea Y106G6D.4 36
  • 33 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes FUS3 35
  • 34 (a)
ManyToMany
KSS1 35
  • 33 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7149 35
  • 19 (a)
OneToMany
Species where no ortholog for MAPK4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MAPK4 Gene

ENSEMBL:
Gene Tree for MAPK4 (if available)
TreeFam:
Gene Tree for MAPK4 (if available)

Paralogs for MAPK4 Gene

Variants for MAPK4 Gene

Sequence variations from dbSNP and Humsavar for MAPK4 Gene

SNP ID Clin Chr 18 pos Sequence Context AA Info Type
rs1000004893 -- 50,727,284(+) ACTCC(A/G/T)AGGGG intron-variant
rs1000027746 -- 50,641,264(+) GTCAC(C/T)AAATC intron-variant
rs1000043491 -- 50,604,367(+) TTTGT(G/T)AAAGC intron-variant
rs1000052926 -- 50,637,979(+) TTCAG(C/T)GTATG intron-variant
rs1000066151 -- 50,599,655(+) CTCAA(A/G)CGGTC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for MAPK4 Gene

Variant ID Type Subtype PubMed ID
dgv987e212 CNV loss 25503493
esv2717094 CNV deletion 23290073
esv34028 CNV loss 18971310
nsv1071462 CNV deletion 25765185
nsv130821 CNV deletion 16902084
nsv2303 CNV insertion 18451855
nsv833651 CNV loss 17160897
nsv953542 CNV deletion 24416366
nsv9630 CNV loss 18304495

Variation tolerance for MAPK4 Gene

Residual Variation Intolerance Score: 16.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.59; 30.70% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MAPK4 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAPK4

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAPK4 Gene

Disorders for MAPK4 Gene

MalaCards: The human disease database

(1) MalaCards diseases for MAPK4 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
pulmonary immaturity
  • primary atelectasis of newborn
- elite association - COSMIC cancer census association via MalaCards
Search MAPK4 in MalaCards View complete list of genes associated with diseases

Relevant External Links for MAPK4

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MAPK4
genes like me logo Genes that share disorders with MAPK4: view

No data available for UniProtKB/Swiss-Prot and Genatlas for MAPK4 Gene

Publications for MAPK4 Gene

  1. Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway. (PMID: 21177870) Deleris P. … Meloche S. (J. Biol. Chem. 2011) 3 4 64
  2. Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif. (PMID: 19473979) Aberg E. … Seternes O.M. (J. Biol. Chem. 2009) 3 22 64
  3. Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5. (PMID: 18720373) DAclAcris P. … Meloche S. (J. Cell. Physiol. 2008) 3 22 64
  4. Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5. (PMID: 16973613) Kant S. … Gaestel M. (J. Biol. Chem. 2006) 3 22 64
  5. Genomic loci of human mitogen-activated protein kinases. (PMID: 8290275) Li L. … Davis R.J. (Oncogene 1994) 2 3 64

Products for MAPK4 Gene

  • Addgene plasmids for MAPK4

Sources for MAPK4 Gene

Content
Loading form....