Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAP3K13 Gene

Aliases for MAP3K13 Gene

  • Mitogen-Activated Protein Kinase Kinase Kinase 13 2 3 5
  • Leucine Zipper-Bearing Kinase 2 3 4
  • Mixed Lineage Kinase 3 4
  • EC 2.7.11.25 4 61
  • LZK 3 4
  • MLK 3 4
  • EC 2.7.11 61
  • MEKK13 3

External Ids for MAP3K13 Gene

Previous GeneCards Identifiers for MAP3K13 Gene

  • GC03P181938
  • GC03P186229
  • GC03P186482
  • GC03P186401
  • GC03P186563
  • GC03P185000
  • GC03P182490

Summaries for MAP3K13 Gene

Entrez Gene Summary for MAP3K13 Gene

  • The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq, Jul 2008]

GeneCards Summary for MAP3K13 Gene

MAP3K13 (Mitogen-Activated Protein Kinase Kinase Kinase 13) is a Protein Coding gene. Among its related pathways are 4-1BB Pathway and NFAT and Cardiac Hypertrophy. GO annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is MAP3K12.

UniProtKB/Swiss-Prot for MAP3K13 Gene

  • Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B.

Gene Wiki entry for MAP3K13 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAP3K13 Gene

Genomics for MAP3K13 Gene

Regulatory Elements for MAP3K13 Gene

Enhancers for MAP3K13 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03G185325 1.9 FANTOM5 Ensembl ENCODE dbSUPER 38.4 +46.5 46523 7.6 PKNOX1 FOXA2 ARID4B DMAP1 YY1 TCF12 GATA2 FOS SP5 TBX21 MAP3K13 EHHADH RPL4P4
GH03G185316 1.7 FANTOM5 Ensembl ENCODE dbSUPER 39 +34.5 34509 2.3 HDAC1 TBP FOXA2 ZBTB40 RARA YY1 RELB CEBPB NR2F2 MAFF MAP3K13 EHHADH C3orf70 RPL4P4
GH03G185335 1.4 Ensembl ENCODE dbSUPER 26.4 +54.3 54291 3.3 ELF3 HNRNPUL1 PKNOX1 FOXA2 THRB ZEB1 RARA RFX5 ZSCAN5C RCOR1 MAP3K13 VPS8 RPL4P4
GH03G185282 1.1 ENCODE 26.9 +0.1 107 1.7 HDGF PKNOX1 ARID4B SIN3A DMAP1 YY1 ZNF207 FOS SP3 SP5 MAP3K13 C3orf70 RPL4P4
GH03G185308 0.7 ENCODE 38.7 +26.5 26530 1.6 SOX5 SOX13 GATAD2A SAP130 NR2F1 ARID4B HMG20A ZNF384 ZNF48 RARA MAP3K13 EHHADH C3orf70 RPL4P4
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MAP3K13 on UCSC Golden Path with GeneCards custom track

Promoters for MAP3K13 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000163037 159 1400 HDGF PKNOX1 ARID4B SIN3A DMAP1 YY1 ZNF207 FOS SP3 SP5

Genomic Location for MAP3K13 Gene

Chromosome:
3
Start:
185,282,941 bp from pter
End:
185,489,097 bp from pter
Size:
206,157 bases
Orientation:
Plus strand

Genomic View for MAP3K13 Gene

Genes around MAP3K13 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAP3K13 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAP3K13 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAP3K13 Gene

Proteins for MAP3K13 Gene

  • Protein details for MAP3K13 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43283-M3K13_HUMAN
    Recommended name:
    Mitogen-activated protein kinase kinase kinase 13
    Protein Accession:
    O43283
    Secondary Accessions:
    • B2R6U2
    • B4DLE3
    • B4DMV2
    • B4DZJ4
    • D3DNU1
    • Q05BY6
    • Q15450
    • Q2NKN3

    Protein attributes for MAP3K13 Gene

    Size:
    966 amino acids
    Molecular mass:
    108296 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer; forms dimers through the leucine-zipper motif. Interacts with the C-terminus of MAPK8IP1 through the kinase catalytic domain. Binds PRDX3. Associates with the IKK complex through the kinase domain.
    SequenceCaution:
    • Sequence=AAI11727.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305}; Sequence=BAG59505.1; Type=Erroneous termination; Positions=740; Note=Translated as Tyr.; Evidence={ECO:0000305};

    Alternative splice isoforms for MAP3K13 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MAP3K13 Gene

Selected DME Specific Peptides for MAP3K13 Gene

O43283:
  • RRREELRHALDIREHYERKLERANNLYMEL
  • STFSSEN
  • LWELLTGE
  • SDGLSDKECAVRRVKTQMSLGKLC
  • LMHLDIA
  • GQLYEVLRAGR
  • GPWGCCQA
  • HLDIASADVL
  • EEEGEVDSEVEFPRRQRPHRCISS
  • TPQETYFKSQAEWREEVK
  • WMAPEVI
  • EEVAIKKVREQ
  • CPDGFKIL
  • LWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSTCPDG
  • IGKAYST
  • GMNYLHLHKIIHRDLKSPN
  • HRDLKSPN
  • GFLEGLFGCLRPVW
  • VKISDFGTSKELSDKSTKMSFAGTVAW
  • KISDFGTSK
  • GSGAQGAVFLG
  • WEVPFEEI
  • HFEKIKSEGTC
  • ETDIKHLRKLKHPNII
  • NNLRYFGPAAALRSPLSNH
  • VEKKYPGTYKRHPVRPI
  • RYRSKPRHRR
  • RNRPSFRQ

Post-translational modifications for MAP3K13 Gene

Domains & Families for MAP3K13 Gene

Suggested Antigen Peptide Sequences for MAP3K13 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O43283

UniProtKB/Swiss-Prot:

M3K13_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
genes like me logo Genes that share domains with MAP3K13: view

Function for MAP3K13 Gene

Molecular function for MAP3K13 Gene

GENATLAS Biochemistry:
mitogen activated protein (MAP/ERK) kinase kinase kinase 13,mixed lineage kinase family,most strongly expressed in pancreas
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by autophosphorylation and homodimerization.
UniProtKB/Swiss-Prot Function:
Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B.

Enzyme Numbers (IUBMB) for MAP3K13 Gene

Gene Ontology (GO) - Molecular Function for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA,IEA 9353328
GO:0004709 MAP kinase kinase kinase activity IEA,IDA 11726277
GO:0005515 protein binding IPI 11726277
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with MAP3K13: view
genes like me logo Genes that share phenotypes with MAP3K13: view

Animal Model Products

  • Taconic Biosciences Mouse Models for MAP3K13

CRISPR Products

miRNA for MAP3K13 Gene

miRTarBase miRNAs that target MAP3K13

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAP3K13 Gene

Localization for MAP3K13 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAP3K13 Gene

Cytoplasm. Membrane; Peripheral membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAP3K13 gene
Compartment Confidence
cytosol 3
nucleus 2
cytoskeleton 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IEA --
GO:0008385 colocalizes_with IkappaB kinase complex IDA 12492477
GO:0016020 membrane IDA,IEA 9353328
genes like me logo Genes that share ontologies with MAP3K13: view

Pathways & Interactions for MAP3K13 Gene

genes like me logo Genes that share pathways with MAP3K13: view

Pathways by source for MAP3K13 Gene

SIGNOR curated interactions for MAP3K13 Gene

Activates:

Gene Ontology (GO) - Biological Process for MAP3K13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000186 activation of MAPKK activity IEA,IDA 11726277
GO:0006468 protein phosphorylation IDA,IEA 9353328
GO:0007254 JNK cascade IDA,IEA 9353328
GO:0016310 phosphorylation IEA --
GO:0046777 protein autophosphorylation IDA,IEA 9353328
genes like me logo Genes that share ontologies with MAP3K13: view

Drugs & Compounds for MAP3K13 Gene

(9) Drugs for MAP3K13 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(2) Additional Compounds for MAP3K13 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with MAP3K13: view

Transcripts for MAP3K13 Gene

Unigene Clusters for MAP3K13 Gene

Mitogen-activated protein kinase kinase kinase 13:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for MAP3K13 Gene

No ASD Table

Relevant External Links for MAP3K13 Gene

GeneLoc Exon Structure for
MAP3K13
ECgene alternative splicing isoforms for
MAP3K13

Expression for MAP3K13 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAP3K13 Gene

Protein differential expression in normal tissues from HIPED for MAP3K13 Gene

This gene is overexpressed in Plasma (69.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for MAP3K13 Gene



Protein tissue co-expression partners for MAP3K13 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of MAP3K13 Gene:

MAP3K13

SOURCE GeneReport for Unigene cluster for MAP3K13 Gene:

Hs.591306

mRNA Expression by UniProt/SwissProt for MAP3K13 Gene:

O43283-M3K13_HUMAN
Tissue specificity: Expressed in the adult brain, liver, placenta and pancreas, with expression strongest in the pancreas.

Evidence on tissue expression from TISSUES for MAP3K13 Gene

  • Nervous system(4.8)
  • Kidney(2.6)
  • Lung(2.2)
genes like me logo Genes that share expression patterns with MAP3K13: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAP3K13 Gene

Orthologs for MAP3K13 Gene

This gene was present in the common ancestor of animals.

Orthologs for MAP3K13 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAP3K13 34 35
  • 99.14 (n)
cow
(Bos Taurus)
Mammalia MAP3K13 34 35
  • 91.37 (n)
dog
(Canis familiaris)
Mammalia MAP3K13 34 35
  • 91.34 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MAP3K13 35
  • 87 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Map3k13 34 16 35
  • 84.78 (n)
rat
(Rattus norvegicus)
Mammalia Map3k13 34
  • 84.36 (n)
oppossum
(Monodelphis domestica)
Mammalia MAP3K13 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves MAP3K13 34 35
  • 76.41 (n)
lizard
(Anolis carolinensis)
Reptilia MAP3K13 35
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100493878 34
  • 69.4 (n)
zebrafish
(Danio rerio)
Actinopterygii si:ch211-45c16.2 34
  • 67.94 (n)
MAP3K13 35
  • 64 (a)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta CG8789 36
  • 62 (a)
wnd 35
  • 36 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea dlk-1 35
  • 31 (a)
OneToMany
Species where no ortholog for MAP3K13 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MAP3K13 Gene

ENSEMBL:
Gene Tree for MAP3K13 (if available)
TreeFam:
Gene Tree for MAP3K13 (if available)

Paralogs for MAP3K13 Gene

(11) SIMAP similar genes for MAP3K13 Gene using alignment to 6 proteins:

Pseudogenes.org Pseudogenes for MAP3K13 Gene

genes like me logo Genes that share paralogs with MAP3K13: view

Variants for MAP3K13 Gene

Sequence variations from dbSNP and Humsavar for MAP3K13 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
VAR_040710 A metastatic melanoma sample
rs1000010127 -- 185,363,242(+) GTGGG(C/T)TGGAG intron-variant, utr-variant-5-prime
rs1000019374 -- 185,360,639(+) AAAGC(A/C)CCCAA intron-variant
rs1000032558 -- 185,311,871(+) AGGAA(A/G)GTGAA intron-variant
rs1000038867 -- 185,405,996(+) TAGTT(G/T)TGACT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for MAP3K13 Gene

Variant ID Type Subtype PubMed ID
dgv183n111 CNV deletion 26073780
dgv2652n106 CNV deletion 24896259
dgv2653n106 CNV duplication 24896259
dgv5002n100 CNV gain 25217958
esv1687636 CNV insertion 17803354
esv1742989 CNV deletion 17803354
esv2339714 CNV deletion 18987734
esv2545135 CNV deletion 19546169
esv2659506 CNV deletion 23128226
esv2726325 CNV deletion 23290073
esv2832347 CNV deletion 24192839
esv3258 CNV loss 18987735
esv3563020 CNV deletion 23714750
esv3598966 CNV gain 21293372
esv3598967 CNV loss 21293372
esv3598968 CNV loss 21293372
esv3893837 CNV gain 25118596
esv7825 CNV loss 19470904
nsv1074113 CNV deletion 25765185
nsv1074114 CNV deletion 25765185
nsv1117357 CNV tandem duplication 24896259
nsv1120466 CNV tandem duplication 24896259
nsv1129705 CNV tandem duplication 24896259
nsv1133331 CNV tandem duplication 24896259
nsv1133332 CNV tandem duplication 24896259
nsv1139184 CNV deletion 24896259
nsv1139185 CNV deletion 24896259
nsv1140347 OTHER inversion 24896259
nsv1146973 CNV duplication 26484159
nsv1152810 CNV insertion 26484159
nsv237556 CNV deletion 16902084
nsv441852 CNV loss 18776908
nsv822366 CNV loss 20364138
nsv829817 CNV gain 17160897
nsv829818 CNV loss 17160897
nsv955530 CNV deletion 24416366
nsv967100 CNV duplication 23825009

Variation tolerance for MAP3K13 Gene

Residual Variation Intolerance Score: 13.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.64; 45.56% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MAP3K13 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAP3K13

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAP3K13 Gene

Disorders for MAP3K13 Gene

Relevant External Links for MAP3K13

Genetic Association Database (GAD)
MAP3K13
Human Genome Epidemiology (HuGE) Navigator
MAP3K13
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MAP3K13

No disorders were found for MAP3K13 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MAP3K13 Gene

Publications for MAP3K13 Gene

  1. Molecular cloning and functional expression of a cDNA encoding a new member of mixed lineage protein kinase from human brain. (PMID: 9353328) Sakuma H. … Kawasaki T. (J. Biol. Chem. 1997) 2 3 4 22 64
  2. Identification and characterization of functional domains in a mixed lineage kinase LZK. (PMID: 11163770) Ikeda A. … Kawasaki T. (FEBS Lett. 2001) 3 4 22 64
  3. Mixed lineage kinase LZK forms a functional signaling complex with JIP-1, a scaffold protein of the c-Jun NH(2)-terminal kinase pathway. (PMID: 11726277) Ikeda A. … Kawasaki T. (J. Biochem. 2001) 3 4 22 64
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64

Products for MAP3K13 Gene

Sources for MAP3K13 Gene

Content
Loading form....