Aliases for LIMK2 Gene
External Ids for LIMK2 Gene
- HGNC: 6614
- Entrez Gene: 3985
- Ensembl: ENSG00000182541
- OMIM: 601988
- UniProtKB: P53671
Previous GeneCards Identifiers for LIMK2 Gene
- GC22P028304
- GC22P029932
- GC22P031608
- GC22P014569
Summaries for LIMK2 Gene
-
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for LIMK2 Gene
LIMK2 (LIM Domain Kinase 2) is a Protein Coding gene. Among its related pathways are Development Slit-Robo signaling and EPH-Ephrin signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is LIMK1.
UniProtKB/Swiss-Prot for LIMK2 Gene
-
Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
-
LIM kinases (LIMKs), EC 2.7.11.1, are dual specificity kinases (serine/threonine and tyrosine), which phosphorylate and inactivate cofilin (a key regulator of actin cytoskeleton dynamics). There are two isoforms of LIMK: LIMK1 and LIMK2.
Additional gene information for LIMK2 Gene
- Monarch Initiative
- Search for LIMK2 at DataMed
- Search for LIMK2 at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for LIMK2 Gene
Genomics for LIMK2 Gene
GeneHancer (GH) Regulatory Elements for LIMK2 Gene
Regulatory Element Products
Genomic Locations for LIMK2 Gene
- chr22:31,212,239-31,280,080
- (GRCh38/hg38)
- Size:
- 67,842 bases
- Orientation:
- Plus strand
- chr22:31,608,225-31,676,066
- (GRCh37/hg19)
Genomic View for LIMK2 Gene
- Cytogenetic band:
-
- 22q12.2 by Ensembl
- 22q12.2 by Entrez Gene
- 22q12.2 by HGNC


RefSeq DNA sequence for LIMK2 Gene
Proteins for LIMK2 Gene
-
Protein details for LIMK2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P53671-LIMK2_HUMAN
- Recommended name:
- LIM domain kinase 2
- Protein Accession:
- P53671
- A8K6H5
- Q7KZ80
- Q7L3H5
- Q96E10
- Q99464
- Q9UFU0
Protein attributes for LIMK2 Gene
- Size:
- 638 amino acids
- Molecular mass:
- 72232 Da
- Quaternary structure:
-
- Binds ROCK1 and MARF1 (Ref.9, PubMed:11018042, PubMed:10436159). Interacts with PARD3. Interacts with NISCH (By similarity).
- SequenceCaution:
-
- Sequence=AAB54055.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Protein Expression for LIMK2 Gene
Selected DME Specific Peptides for LIMK2 Gene
- P53671:
-
- RYTVVGNPYWMAPEM
- HPNVLKFIGVLYK
- VLKFIGVLYKDK
- CHGCSLLMTGP
- GMAYLHSM
- DPFPWQQKV
- FSFGIVLCEIIG
- IIHRDLN
- SCFRCSECQ
- DRILEING
- KYHPECF
- TLYCGKCHN
- SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVM
Post-translational modifications for LIMK2 Gene
- Phosphorylated on serine and/or threonine residues by ROCK1.
Other Protein References for LIMK2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for LIMK2 (LIMK2)
-
Custom Antibody ServicesOriGene Antibodies for LIMK2
- Novus Biologicals Antibodies for LIMK2
-
Abcam antibodies for LIMK2
- Invitrogen Antibodies for LIMK2
- GeneTex LIMK2 antibody for LIMK2
-
Santa Cruz Biotechnology (SCBT) Antibodies for LIMK2
Protein Products
-
OriGene Purified Proteins for LIMK2
- Search Origene for MassSpec and Protein Over-expression Lysates for LIMK2
- Origene Custom Protein Services for LIMK2
- Search GeneTex for Proteins for LIMK2
-
Abcam proteins for LIMK2
Assay Products
Domains & Families for LIMK2 Gene
Gene Families for LIMK2 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for LIMK2 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for LIMK2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P53671UniProtKB/Swiss-Prot:
LIMK2_HUMAN :- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
Function for LIMK2 Gene
Molecular function for LIMK2 Gene
- GENATLAS Biochemistry:
- LIM motif containing protein kinase 2,cytosolic,alternatively spliced in two isoforms LIMK2A and LIMK2B differentially regulated in a tissue specific manner
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
Enzyme Numbers (IUBMB) for LIMK2 Gene
Phenotypes From GWAS Catalog for LIMK2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004674 | protein serine/threonine kinase activity | TAS | 8537403 |
GO:0004871 | signal transducer activity | IBA | -- |
GO:0005515 | protein binding | IPI | 22939624 |
GO:0005524 | ATP binding | IEA | -- |
Phenotypes for LIMK2 Gene
- MGI mutant phenotypes for LIMK2:
-
inferred from 5 alleles
- cardiovascular system phenotype
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- vision/eye phenotype
- hearing/vestibular/ear phenotype
- skeleton phenotype
- renal/urinary system phenotype
- craniofacial phenotype
- adipose tissue phenotype
- no phenotypic analysis
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for LIMK2:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased ionizing radiation sensitivity
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased viability after Maraba virus infection
- Decreased viability
- Decreased substrate adherent cell growth
- Increased HPV18 LCR reporter activity
- Decreased cell migration
- Decreased shRNA abundance (Z-score < -2)
- Increased cell number in S
- Increased cell viability after pRB stimulation
- Increased epidermal growth factor receptor (EGFR) surface abundance
- Decreased HIV-1 infection
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIMK2
-
-
ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
- Search ViGene Biosciences for LIMK2
CRISPR Products
-
OriGene CRISPR knockouts for LIMK2
- genomics-online: gRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- Applied Biological Materials CRISPR for LIMK2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
miRNA for LIMK2 Gene
- miRTarBase miRNAs that target LIMK2
miRNA Products
- Search ViGene Biosciences for LIMK2
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
- genomics-online: shRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
Clone Products
-
OriGene ORF clones in human for LIMK2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for LIMK2
- genomics-online: cdna clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- orf clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- Applied Biological Materials Clones for LIMK2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for LIMK2
-
ViGene Biosciences adenoviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for LIMK2 Gene
Localization for LIMK2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for LIMK2 Gene
- Isoform LIMK2a: Cytoplasm. Nucleus. Note=Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
- Isoform LIMK2b: Cytoplasm. Nucleus. Note=Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.
- Cytosol (3)
- Nucleoplasm (3)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005634 | nucleus | TAS | 8954941 |
GO:0005737 | cytoplasm | TAS | 8537403 |
GO:0005801 | cis-Golgi network | IEA | -- |
Pathways & Interactions for LIMK2 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Semaphorin interactions | ||
2 | Actin Nucleation by ARP-WASP Complex |
.41
|
.35
|
3 | EPH-Ephrin signaling | ||
4 | Apoptotic Pathways in Synovial Fibroblasts |
.65
|
|
5 | fMLP Pathway |
Pathways by source for LIMK2 Gene
1 Sino Biological pathway for LIMK2 Gene
1 Cell Signaling Technology pathway for LIMK2 Gene
5 BioSystems pathways for LIMK2 Gene
11 Reactome pathways for LIMK2 Gene
3 KEGG pathways for LIMK2 Gene
6 GeneGo (Thomson Reuters) pathways for LIMK2 Gene
- Cell adhesion Integrin-mediated cell adhesion and migration
- Cytoskeleton remodeling CDC42 in cellular processes
- Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
- Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
- Immune response CCR3 signaling in eosinophils
14 Qiagen pathways for LIMK2 Gene
Interacting Proteins for LIMK2 Gene
SIGNOR curated interactions for LIMK2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | IEA | -- |
GO:0007283 | spermatogenesis | IEA | -- |
GO:0016310 | phosphorylation | TAS | 8537403 |
GO:0035556 | intracellular signal transduction | IBA | -- |
GO:0042325 | regulation of phosphorylation | IEA | -- |
Drugs & Compounds for LIMK2 Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
SR 7826 |
|
1219728-20-7 |
|
|
||
T 5601640 |
|
924473-59-6 |
|
|
(3) Tocris Compounds for LIMK2 Gene
(1) ApexBio Compounds for LIMK2 Gene
Compound | Action | Cas Number |
---|---|---|
LIMKi 3 | LIMK2 inhibitor | 1338247-35-0 |
Transcripts for LIMK2 Gene
mRNA/cDNA for LIMK2 Gene
- (3) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (710) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for LIMK2
- genomics-online: gRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- Applied Biological Materials CRISPR for LIMK2
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
miRNA Products
- Search ViGene Biosciences for LIMK2
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
- genomics-online: shRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
Clone Products
-
OriGene ORF clones in human for LIMK2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for LIMK2
- genomics-online: cdna clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- orf clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
- Applied Biological Materials Clones for LIMK2
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2a | · | 2b | ^ | 3a | · | 3b | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | ^ | 8a | · | 8b | ^ | 9a | · | 9b | · | 9c | ^ | 10 | ^ | 11a | · | 11b | ^ | 12 | ^ | 13 | ^ |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
SP2: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP3: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
SP6: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP9: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
SP10: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP11: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP15: |
ExUns: | 14a | · | 14b | · | 14c | ^ | 15a | · | 15b | ^ | 16a | · | 16b | ^ | 17 | ^ | 18a | · | 18b |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | ||||||||||||||||
SP2: | - | - | - | ||||||||||||||||
SP3: | - | ||||||||||||||||||
SP4: | - | - | |||||||||||||||||
SP5: | |||||||||||||||||||
SP6: | |||||||||||||||||||
SP7: | |||||||||||||||||||
SP8: | |||||||||||||||||||
SP9: | |||||||||||||||||||
SP10: | |||||||||||||||||||
SP11: | |||||||||||||||||||
SP12: | |||||||||||||||||||
SP13: | |||||||||||||||||||
SP14: | |||||||||||||||||||
SP15: |
Expression for LIMK2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Granulocytes Peripheral Blood
- T Helper Cells Peripheral Blood
- T-Cytotoxic Cells Peripheral Blood
- Hematopoietic Bone Marrow
- Brain (Nervous System)
-
Eye (Sensory Organs)
- Cholinergic Amacrine Cells Inner Nuclear Layer
-
Neurons
- Cholinergic Amacrine Cells Inner Nuclear Layer
-
Testis (Reproductive System)
- Leydig Cells Testis Interstitium
-
Trophoblast (Extraembryonic Tissues)
- Mural Trophectoderm Cells Mural Trophectoderm
- Thyroid (Endocrine System)
- Intestine (Gastrointestinal Tract)
- Pancreas (Endocrine System)
- Ovary (Reproductive System)
mRNA differential expression in normal tissues according to GTEx for LIMK2 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for LIMK2 Gene
NURSA nuclear receptor signaling pathways regulating expression of LIMK2 Gene:
LIMK2SOURCE GeneReport for Unigene cluster for LIMK2 Gene:
Hs.474596mRNA Expression by UniProt/SwissProt for LIMK2 Gene:
P53671-LIMK2_HUMANEvidence on tissue expression from TISSUES for LIMK2 Gene
- Lung(4.5)
- Nervous system(4.4)
Primer Products
-
OriGene qPCR primer pairs for LIMK2
-
OriGene qPCR primer pairs and template standards for LIMK2
- genomics-online: primer clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
-
Recommended
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for LIMK2 Gene
Orthologs for LIMK2 Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | LIMK2 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | LIMK2 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | LIMK2 33 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Limk2 33 |
|
||
mouse (Mus musculus) |
Mammalia | Limk2 33 16 34 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | LIMK2 34 |
|
OneToOne | |
oppossum (Monodelphis domestica) |
Mammalia | LIMK2 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | LIMK2 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
ManyToMany | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | limk2 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | limk2 33 34 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | LIMK1 34 |
|
OneToMany | |
worm (Caenorhabditis elegans) |
Secernentea | K09B11.5 34 |
|
ManyToMany | |
kin-21 34 |
|
ManyToMany | |||
Y52D5A.2 34 |
|
ManyToMany | |||
T25B9.5 34 |
|
ManyToMany | |||
Y69E1A.3 34 |
|
ManyToMany | |||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany |
- Species where no ortholog for LIMK2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for LIMK2 Gene
(9) SIMAP similar genes for LIMK2 Gene using alignment to 7 proteins:
Pseudogenes.org Pseudogenes for LIMK2 Gene
Variants for LIMK2 Gene
SNP ID | Clin | Chr 22 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000015860 | -- | 31,212,744(+) | C/T | genic_upstream_transcript_variant, intron_variant | |
rs1000068151 | -- | 31,212,454(+) | C/G | genic_upstream_transcript_variant, intron_variant | |
rs1000084059 | -- | 31,271,243(+) | C/G | intron_variant | |
rs1000139953 | -- | 31,264,502(+) | G/A | intron_variant | |
rs1000151162 | -- | 31,218,941(+) | G/A | genic_upstream_transcript_variant, intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
esv2543296 | CNV | insertion | 19546169 |
esv3436353 | CNV | duplication | 20981092 |
nsv1110864 | OTHER | inversion | 24896259 |
nsv1125754 | CNV | tandem duplication | 24896259 |
nsv459871 | CNV | loss | 19166990 |
nsv588893 | CNV | loss | 21841781 |
nsv962787 | CNV | duplication | 23825009 |
Additional Variant Information for LIMK2 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for LIMK2 Gene
Disorders for LIMK2 Gene
Additional Disease Information for LIMK2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for LIMK2 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for LIMK2 Gene
Publications for LIMK2 Gene
- Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs. (PMID: 8537403) Okano I … Mizuno K (The Journal of biological chemistry 1995) 2 3 4 22 58
- Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase. (PMID: 11018042) Sumi T … Nakamura T (The Journal of biological chemistry 2001) 3 4 22 58
- Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha. (PMID: 11340065) Sumi T … Nakamura T (The Journal of biological chemistry 2001) 3 4 22 58
- The DNA sequence of human chromosome 22. (PMID: 10591208) Dunham I … O'Brien KP (Nature 1999) 2 3 4 58
- A genome-wide association study for diabetic nephropathy genes in African Americans. (PMID: 21150874) McDonough CW … Bowden DW (Kidney international 2011) 3 44 58
Products for LIMK2 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for LIMK2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for LIMK2
- Search Origene for MassSpec and Protein Over-expression Lysates for LIMK2
- Origene Custom Protein Services for LIMK2
- Origene shrna, sirna, and RNAi products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
- OriGene qPCR primer pairs and template standards for LIMK2
- OriGene qPCR primer pairs for LIMK2
- OriGene CRISPR knockouts for LIMK2
- OriGene ORF clones in human for LIMK2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For LIMK2
- GenScript: Next-day shipping of latest version cDNA ORF clones for LIMK2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for LIMK2
- GenScript Custom Assay Services for LIMK2
- GenScript Custom overexpressing Cell Line Services for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for LIMK2
- Cell Signaling Technology (CST) Antibodies for LIMK2 (LIMK2)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for LIMK2
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for LIMK2
- Novus Biologicals lysates and proteins for LIMK2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for LIMK2
- Abcam proteins for LIMK2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for LIMK2
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIMK2
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for LIMK2
- antibodies-online: Search results for 138 available LIMK2 Antibodies ranked by validation data
- Compare Top LIMK2 Antibodies
- antibodies-online: Search results for 7 available LIMK2 Elisa Kits ranked by validation data
- Compare Top LIMK2 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 10 available LIMK2 Proteins ranked by validation data
- Compare Top LIMK2 Proteins
- Quality Products:
- GeneTex LIMK2 antibody for LIMK2
- Search GeneTex for Proteins for LIMK2
- ViGene Biosciences adenoviral particle packaged cDNA for LIMK2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
- Search ViGene Biosciences for LIMK2
- Santa Cruz Biotechnology (SCBT) Antibodies for LIMK2
- Search Santa Cruz Biotechnology (SCBT) for LIMK2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- Horizon Cell Lines for LIMK2
- genomics-online: cdna clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
- Recommended
- orf clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
- Recommended
- genomics-online: gRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
- Recommended
- genomics-online: primer clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
- Recommended
- genomics-online: shRNA clones - Search results for 152 available LIMK2 gene related products
- Overview of 152 available LIMK2 gene related products
- Recommended
Sources for LIMK2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew