Aliases for LIMK2 Gene
External Ids for LIMK2 Gene
- HGNC: 6614
- Entrez Gene: 3985
- Ensembl: ENSG00000182541
- OMIM: 601988
- UniProtKB: P53671
Previous GeneCards Identifiers for LIMK2 Gene
- GC22P028304
- GC22P029932
- GC22P031608
- GC22P014569
Summaries for LIMK2 Gene
-
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for LIMK2 Gene
LIMK2 (LIM Domain Kinase 2) is a Protein Coding gene. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and EPHA forward signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is LIMK1.
UniProtKB/Swiss-Prot for LIMK2 Gene
-
Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
-
LIM kinases (LIMKs), EC 2.7.11.1, are dual specificity kinases (serine/threonine and tyrosine), which phosphorylate and inactivate cofilin (a key regulator of actin cytoskeleton dynamics). There are two isoforms of LIMK: LIMK1 and LIMK2.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for LIMK2 Gene
Genomics for LIMK2 Gene
Regulatory Elements for LIMK2 Gene
Enhancers for LIMK2 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around LIMK2 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for LIMK2 Gene
- Chromosome:
- 22
- Start:
- 31,212,239 bp from pter
- End:
- 31,280,080 bp from pter
- Size:
- 67,842 bases
- Orientation:
- Plus strand
Genomic View for LIMK2 Gene
Genes around LIMK2 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 22q12.2 by Ensembl
- 22q12.2 by Entrez Gene
- 22q12.2 by HGNC
LIMK2 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for LIMK2 Gene
Proteins for LIMK2 Gene
-
Protein details for LIMK2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P53671-LIMK2_HUMAN
- Recommended name:
- LIM domain kinase 2
- Protein Accession:
- P53671
- A8K6H5
- Q7KZ80
- Q7L3H5
- Q96E10
- Q99464
- Q9UFU0
Protein attributes for LIMK2 Gene
- Size:
- 638 amino acids
- Molecular mass:
- 72232 Da
- Quaternary structure:
-
- Binds ROCK1 and LKAP. Interacts with PARD3. Interacts with NISCH (By similarity).
- SequenceCaution:
-
- Sequence=AAB54055.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Protein Expression for LIMK2 Gene
Selected DME Specific Peptides for LIMK2 Gene
- P53671:
-
- RYTVVGNPYWMAPEM
- HPNVLKFIGVLYK
- VLKFIGVLYKDK
- CHGCSLLMTGP
- GMAYLHSM
- DPFPWQQKV
- FSFGIVLCEIIG
- IIHRDLN
- SCFRCSECQ
- DRILEING
- KYHPECF
- TLYCGKCHN
- SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVM
Post-translational modifications for LIMK2 Gene
- Phosphorylated on serine and/or threonine residues by ROCK1.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for LIMK2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for LIMK2 (LIMK2)
- Novus Biologicals Antibodies for LIMK2
-
Abcam antibodies for LIMK2
- Invitrogen Antibodies for LIMK2
- antibodies-online Antibodies for LIMK2: See all 141
- GeneTex LIMK2 antibody for LIMK2
-
Santa Cruz Biotechnology (SCBT) Antibodies for LIMK2
Protein Products
-
OriGene Purified Proteins for LIMK2
- Search Origene for MassSpec and Protein Over-expression Lysates for LIMK2
- Origene Custom Protein Services for LIMK2
- antibodies-online Proteins for LIMK2: See all 11
- Search antibodies-online for peptides
- Search GeneTex for Proteins for LIMK2
Assay Products
- antibodies-online Kits for LIMK2: See all 1
Domains & Families for LIMK2 Gene
Gene Families for LIMK2 Gene
Protein Domains for LIMK2 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for LIMK2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P53671UniProtKB/Swiss-Prot:
LIMK2_HUMAN :- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
Function for LIMK2 Gene
Molecular function for LIMK2 Gene
- GENATLAS Biochemistry:
- LIM motif containing protein kinase 2,cytosolic,alternatively spliced in two isoforms LIMK2A and LIMK2B differentially regulated in a tissue specific manner
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.
Enzyme Numbers (IUBMB) for LIMK2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | TAS | 8537403 |
| GO:0004871 | signal transducer activity | IBA | -- |
| GO:0005515 | protein binding | IPI | 22939624 |
| GO:0005524 | ATP binding | IEA | -- |
Phenotypes for LIMK2 Gene
- MGI mutant phenotypes for LIMK2:
-
inferred from 5 alleles
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- immune system phenotype
- cardiovascular system phenotype
- reproductive system phenotype
- endocrine/exocrine gland phenotype
- vision/eye phenotype
- hearing/vestibular/ear phenotype
- limbs/digits/tail phenotype
- skeleton phenotype
- renal/urinary system phenotype
- craniofacial phenotype
- adipose tissue phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for LIMK2:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased ionizing radiation sensitivity
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased viability after Maraba virus infection
- Decreased viability
- Decreased substrate adherent cell growth
- Increased HPV18 LCR reporter activity
- Decreased cell migration
- Decreased shRNA abundance (Z-score < -2)
- Increased cell number in S
- Increased cell viability after pRB stimulation
- Increased epidermal growth factor receptor (EGFR) surface abundance
- Decreased HIV-1 infection
Animal Model Products
-
Taconic Biosciences Mouse Models for LIMK2
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIMK2
-
-
ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
- Search ViGene Biosciences for LIMK2
CRISPR Products
-
OriGene CRISPR knockouts for LIMK2
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
miRNA for LIMK2 Gene
- miRTarBase miRNAs that target LIMK2
miRNA Products
- Search ViGene Biosciences for LIMK2
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
Clone Products
- Sino Biological Human cDNA Clone for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for LIMK2
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for LIMK2
-
ViGene Biosciences adenoviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for LIMK2 Gene
Localization for LIMK2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for LIMK2 Gene
- Isoform LIMK2a: Cytoplasm. Nucleus. Note=Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
- Isoform LIMK2b: Cytoplasm. Nucleus. Note=Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 3 |
| cytoskeleton | 2 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | TAS | 8954941 |
| GO:0005737 | cytoplasm | TAS | 8537403 |
| GO:0005801 | cis-Golgi network | IEA | -- |
Pathways & Interactions for LIMK2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Semaphorin interactions | ||
| 2 | Actin Nucleation by ARP-WASP Complex |
.41
|
.35
|
| 3 | EPH-Ephrin signaling | ||
| 4 | Apoptotic Pathways in Synovial Fibroblasts |
.65
|
|
| 5 | fMLP Pathway | ||
Pathways by source for LIMK2 Gene
1 Sino Biological pathway for LIMK2 Gene
1 Cell Signaling Technology pathway for LIMK2 Gene
5 BioSystems pathways for LIMK2 Gene
11 Reactome pathways for LIMK2 Gene
3 KEGG pathways for LIMK2 Gene
6 GeneGo (Thomson Reuters) pathways for LIMK2 Gene
- Cell adhesion Integrin-mediated cell adhesion and migration
- Cytoskeleton remodeling CDC42 in cellular processes
- Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
- Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
- Immune response CCR3 signaling in eosinophils
14 Qiagen pathways for LIMK2 Gene
Interacting Proteins for LIMK2 Gene
Selected Interacting proteins:
P53671-LIMK2_HUMAN
ENSP00000339916
for LIMK2 Gene via
MINT
STRING
UniProtKB
IID
SIGNOR curated interactions for LIMK2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0007283 | spermatogenesis | IEA | -- |
| GO:0016310 | phosphorylation | TAS | 8537403 |
| GO:0035556 | intracellular signal transduction | IBA | -- |
| GO:0042325 | regulation of phosphorylation | IEA | -- |
Drugs & Compounds for LIMK2 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| SR 7826 |
|
1219728-20-7 |
|
|
||
| T 5601640 |
|
924473-59-6 |
|
|
(3) Tocris Compounds for LIMK2 Gene
(1) ApexBio Compounds for LIMK2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| LIMKi 3 | LIMK2 inhibitor | 1338247-35-0 |
Transcripts for LIMK2 Gene
mRNA/cDNA for LIMK2 Gene
- (3) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (710) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for LIMK2
-
Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
miRNA Products
- Search ViGene Biosciences for LIMK2
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
-
ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
Clone Products
- Sino Biological Human cDNA Clone for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for LIMK2
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2a | · | 2b | ^ | 3a | · | 3b | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | ^ | 8a | · | 8b | ^ | 9a | · | 9b | · | 9c | ^ | 10 | ^ | 11a | · | 11b | ^ | 12 | ^ | 13 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP3: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: |
| ExUns: | 14a | · | 14b | · | 14c | ^ | 15a | · | 15b | ^ | 16a | · | 16b | ^ | 17 | ^ | 18a | · | 18b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||
| SP3: | - | ||||||||||||||||||
| SP4: | - | - | |||||||||||||||||
| SP5: | |||||||||||||||||||
| SP6: | |||||||||||||||||||
| SP7: | |||||||||||||||||||
| SP8: | |||||||||||||||||||
| SP9: | |||||||||||||||||||
| SP10: | |||||||||||||||||||
| SP11: | |||||||||||||||||||
| SP12: | |||||||||||||||||||
| SP13: | |||||||||||||||||||
| SP14: | |||||||||||||||||||
| SP15: |
Expression for LIMK2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Granulocytes Peripheral Blood
- T Helper Cells Peripheral Blood
- T-Cytotoxic Cells Peripheral Blood
- Hematopoietic Bone Marrow
- Brain (Nervous System)
-
Eye (Sensory Organs)
- Cholinergic Amacrine Cells Inner Nuclear Layer
-
Neurons
- Cholinergic Amacrine Cells Inner Nuclear Layer
-
Testis (Reproductive System)
- Leydig Cells Testis Interstitium
-
Trophoblast (Extraembryonic Tissues)
- Mural Trophectoderm Cells Mural Trophectoderm
- Thyroid (Endocrine System)
- Intestine (Gastrointestinal Tract)
- Pancreas (Endocrine System)
- Ovary (Reproductive System)
mRNA differential expression in normal tissues according to GTEx for LIMK2 Gene
This gene is overexpressed in Whole Blood (x11.5).
This gene is overexpressed in Pancreatic juice (42.2), Placenta (12.6), and Heart (11.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for LIMK2 Gene
NURSA nuclear receptor signaling pathways regulating expression of LIMK2 Gene:
LIMK2SOURCE GeneReport for Unigene cluster for LIMK2 Gene:
Hs.474596mRNA Expression by UniProt/SwissProt for LIMK2 Gene:
P53671-LIMK2_HUMAN
Tissue specificity:
Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.
Evidence on tissue expression from TISSUES for LIMK2 Gene
- Lung(4.5)
- Nervous system(4.4)
Primer Products
-
OriGene qPCR primer pairs and template standards for LIMK2
-
OriGene qPCR primer pairs for LIMK2
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for LIMK2 Gene
Orthologs for LIMK2 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | LIMK2 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | LIMK2 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | LIMK2 34 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Limk2 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Limk2 34 16 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | LIMK2 35 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | LIMK2 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | LIMK2 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | -- 35 |
|
ManyToMany | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | limk2 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | limk2 34 35 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | LIMK1 35 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | K09B11.5 35 |
|
ManyToMany | |
| kin-21 35 |
|
ManyToMany | |||
| Y52D5A.2 35 |
|
ManyToMany | |||
| T25B9.5 35 |
|
ManyToMany | |||
| Y69E1A.3 35 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
OneToMany |
- Species where no ortholog for LIMK2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for LIMK2 Gene
(9) SIMAP similar genes for LIMK2 Gene using alignment to 7 proteins:
Pseudogenes.org Pseudogenes for LIMK2 Gene
Variants for LIMK2 Gene
| SNP ID | Clin | Chr 22 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000015860 | -- | 31,212,744(+) | GGGAC(C/T)TGGCG | intron-variant | |
| rs1000068151 | -- | 31,212,454(+) | TCCCG(C/G)TGTTA | intron-variant | |
| rs1000084059 | -- | 31,271,243(+) | CTATC(C/G)TTCCT | intron-variant | |
| rs1000139953 | -- | 31,264,502(+) | ACCAT(A/G)ACTAT | intron-variant | |
| rs1000151162 | -- | 31,218,941(+) | TCTCA(A/G)TGCTT | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2543296 | CNV | insertion | 19546169 |
| esv3436353 | CNV | duplication | 20981092 |
| nsv1110864 | OTHER | inversion | 24896259 |
| nsv1125754 | CNV | tandem duplication | 24896259 |
| nsv459871 | CNV | loss | 19166990 |
| nsv588893 | CNV | loss | 21841781 |
| nsv962787 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
13.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
5.49;
71.73% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for LIMK2 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for LIMK2 Gene
Disorders for LIMK2 Gene
Relevant External Links for LIMK2
No disorders were found for LIMK2 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for LIMK2 Gene
Publications for LIMK2 Gene
- Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs. (PMID: 8537403) Okano I. … Mizuno K. (J. Biol. Chem. 1995) 2 3 4 22 64
- Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase. (PMID: 11018042) Sumi T. … Nakamura T. (J. Biol. Chem. 2001) 3 4 22 64
- Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42- binding kinase alpha. (PMID: 11340065) Sumi T. … Nakamura T. (J. Biol. Chem. 2001) 3 4 22 64
- The DNA sequence of human chromosome 22. (PMID: 10591208) Dunham I. … Wright H. (Nature 1999) 2 3 4 64
- A genome-wide association study for diabetic nephropathy genes in African Americans. (PMID: 21150874) McDonough C.W. … Bowden D.W. (Kidney Int. 2011) 3 46 64
Products for LIMK2 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for LIMK2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for LIMK2
- Search Origene for MassSpec and Protein Over-expression Lysates for LIMK2
- Origene Custom Protein Services for LIMK2
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for LIMK2
- Browse OriGene Inhibitory RNA Products For LIMK2
- OriGene qPCR primer pairs and template standards for LIMK2
- OriGene qPCR primer pairs for LIMK2
- OriGene CRISPR knockouts for LIMK2
- OriGene ORF clones in human for LIMK2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For LIMK2
- GenScript: Next-day shipping cDNA ORF clone for LIMK2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for LIMK2
- GenScript Custom Assay Services for LIMK2
- GenScript Custom overexpressing Cell Line Services for LIMK2
- GenScript: Design CRISPR guide RNA sequences for LIMK2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for LIMK2
- Cell Signaling Technology (CST) Antibodies for LIMK2 (LIMK2)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for LIMK2
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for LIMK2
- Novus Biologicals proteins and lysates for LIMK2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for LIMK2
- Find your target
- Search knockout validated antibodies
- Browse monoclonal antibodies
- Taconic Biosciences Mouse Models for LIMK2
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for LIMK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for LIMK2
- Addgene plasmids for LIMK2
- antibodies-online Antibodies for LIMK2: See all 141
- antibodies-online Kits for LIMK2: See all 1
- antibodies-online Proteins for LIMK2: See all 11
- Search antibodies-online for peptides
- GeneTex LIMK2 antibody for LIMK2
- Search GeneTex for Proteins for LIMK2
- ViGene Biosciences adenoviral particle packaged cDNA for LIMK2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for LIMK2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for LIMK2 gene
- Search ViGene Biosciences for LIMK2
- Santa Cruz Biotechnology (SCBT) Antibodies for LIMK2
- Search Santa Cruz Biotechnology (SCBT) for LIMK2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for LIMK2
- Horizon Cell Lines for LIMK2
- Cyagen custom Knockout/knockin (KOKI) mouse models for LIMK2
- VectorBuilder custom plasmid, inducible vectors for LIMK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for LIMK2
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for LIMK2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer