Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ILKAP Gene

Aliases for ILKAP Gene

  • ILK Associated Serine/Threonine Phosphatase 2 3 5
  • Integrin-Linked Kinase-Associated Serine/Threonine Phosphatase 2C 2 3
  • Protein Phosphatase, Mg2+/Mn2+ Dependent 1O 2 3
  • EC 3.1.3.16 4 61
  • Integrin-Linked Kinase-Associated Serine/Threonine Phosphatase 2
  • Integrin-Linked Kinase Associated Phosphatase 3
  • Protein Phosphatase 2c, Delta Isozyme 3
  • PP2C-DELTA 3
  • ILKAP2 3
  • ILKAP3 3
  • PPM1O 3

External Ids for ILKAP Gene

Previous GeneCards Identifiers for ILKAP Gene

  • GC02M237128
  • GC02M237760
  • GC02M239095
  • GC02M239365
  • GC02M238861
  • GC02M238743
  • GC02M230870
  • GC02M239079

Summaries for ILKAP Gene

Entrez Gene Summary for ILKAP Gene

  • The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq, Jul 2008]

GeneCards Summary for ILKAP Gene

ILKAP (ILK Associated Serine/Threonine Phosphatase) is a Protein Coding gene. Among its related pathways are AKT Signaling Pathway. GO annotations related to this gene include protein serine/threonine phosphatase activity. An important paralog of this gene is PPM1F.

UniProtKB/Swiss-Prot for ILKAP Gene

  • Protein phosphatase that may play a role in regulation of cell cycle progression via dephosphorylation of its substrates whose appropriate phosphorylation states might be crucial for cell proliferation. Selectively associates with integrin linked kinase (ILK), to modulate cell adhesion and growth factor signaling. Inhibits the ILK-GSK3B signaling axis and may play an important role in inhibiting oncogenic transformation.

Gene Wiki entry for ILKAP Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ILKAP Gene

Genomics for ILKAP Gene

Regulatory Elements for ILKAP Gene

Enhancers for ILKAP Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH02G237963 1.7 FANTOM5 Ensembl ENCODE 18 +237.0 236954 6.2 MLX CREB3L1 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 SP3 NFYC TBX21 UBE2F SCLY ILKAP RAMP1 ESPNL KLHL30 ASB1 HES6 LRRFIP1 GC02P237968
GH02G238845 1.9 FANTOM5 Ensembl ENCODE dbSUPER 14.3 -657.1 -657122 30.9 FOXA2 MLX ZFP64 ARID4B SIN3A FEZF1 DMAP1 YBX1 FOS ZNF263 ILKAP TWIST2 LOC151174 GC02M238886
GH02G237612 2.3 VISTA FANTOM5 Ensembl ENCODE dbSUPER 9.9 +587.6 587578 7.1 FOXA2 ATF1 MLX ZFP64 SIN3A ARID4B DMAP1 YBX1 ZNF48 ETS1 ILKAP ENSG00000227107 LRRFIP1 RBM44 LOC105373958
GH02G237685 1.8 FANTOM5 ENCODE dbSUPER 11.6 +511.3 511346 13.1 HDGF PKNOX1 FOXA2 MLX WRNIP1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 LRRFIP1 ILKAP RAB17 LOC105373958 RNU6-1140P PRLH RBM44 ESPNL UBE2F PIR56300
GH02G238239 1.6 Ensembl ENCODE dbSUPER 12.8 -38.1 -38061 5.0 PKNOX1 ARNT MLX AGO1 ZFP64 ARID4B SIN3A DMAP1 ZBTB7B ZNF143 ENSG00000225057 LOC151174 ILKAP TRAF3IP1 ERFE PER2 LOC105373961 ESPNL HES6 GC02M238288
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ILKAP on UCSC Golden Path with GeneCards custom track

Promoters for ILKAP Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000132796 529 1601 ZFP64 SIN3A DMAP1 ZNF143 ZNF207 KLF13 SP5 MXD4 ZNF592 KAT8

Genomic Location for ILKAP Gene

Chromosome:
2
Start:
238,170,401 bp from pter
End:
238,203,729 bp from pter
Size:
33,329 bases
Orientation:
Minus strand

Genomic View for ILKAP Gene

Genes around ILKAP on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ILKAP Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ILKAP Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ILKAP Gene

Proteins for ILKAP Gene

  • Protein details for ILKAP Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H0C8-ILKAP_HUMAN
    Recommended name:
    Integrin-linked kinase-associated serine/threonine phosphatase 2C
    Protein Accession:
    Q9H0C8
    Secondary Accessions:
    • B3KM39

    Protein attributes for ILKAP Gene

    Size:
    392 amino acids
    Molecular mass:
    42907 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Interacts with ILK. Specific association with ILK is independent of the catalytic activity of either partner.

neXtProt entry for ILKAP Gene

Selected DME Specific Peptides for ILKAP Gene

Q9H0C8:
  • GDSRAILCR
  • ISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTAT
  • NLGDSRA
  • VFDGHGG
  • LKGYVAERKGEREEMQDAHVILNDIT

Post-translational modifications for ILKAP Gene

  • Ubiquitination at posLast=161161
  • Modification sites at PhosphoSitePlus

Domains & Families for ILKAP Gene

Gene Families for ILKAP Gene

Protein Domains for ILKAP Gene

Graphical View of Domain Structure for InterPro Entry

Q9H0C8

UniProtKB/Swiss-Prot:

ILKAP_HUMAN :
  • Belongs to the PP2C family.
Family:
  • Belongs to the PP2C family.
genes like me logo Genes that share domains with ILKAP: view

Function for ILKAP Gene

Molecular function for ILKAP Gene

UniProtKB/Swiss-Prot CatalyticActivity:
[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited rather than stimulated by magnesium.
UniProtKB/Swiss-Prot Function:
Protein phosphatase that may play a role in regulation of cell cycle progression via dephosphorylation of its substrates whose appropriate phosphorylation states might be crucial for cell proliferation. Selectively associates with integrin linked kinase (ILK), to modulate cell adhesion and growth factor signaling. Inhibits the ILK-GSK3B signaling axis and may play an important role in inhibiting oncogenic transformation.

Enzyme Numbers (IUBMB) for ILKAP Gene

Gene Ontology (GO) - Molecular Function for ILKAP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004721 phosphoprotein phosphatase activity IEA --
GO:0004722 protein serine/threonine phosphatase activity IEA --
GO:0005515 protein binding IPI 11331582
GO:0016301 kinase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with ILKAP: view
genes like me logo Genes that share phenotypes with ILKAP: view

Animal Model Products

  • Taconic Biosciences Mouse Models for ILKAP

CRISPR Products

miRNA for ILKAP Gene

miRTarBase miRNAs that target ILKAP

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ILKAP

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ILKAP Gene

Localization for ILKAP Gene

Subcellular locations from UniProtKB/Swiss-Prot for ILKAP Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ILKAP gene
Compartment Confidence
nucleus 3
cytosol 3

Gene Ontology (GO) - Cellular Components for ILKAP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with ILKAP: view

Pathways & Interactions for ILKAP Gene

SuperPathways for ILKAP Gene

SuperPathway Contained pathways
1 AKT Signaling Pathway
genes like me logo Genes that share pathways with ILKAP: view

Pathways by source for ILKAP Gene

1 Sino Biological pathway for ILKAP Gene

Gene Ontology (GO) - Biological Process for ILKAP Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006470 protein dephosphorylation IEA --
GO:0007229 integrin-mediated signaling pathway IEA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with ILKAP: view

No data available for SIGNOR curated interactions for ILKAP Gene

Drugs & Compounds for ILKAP Gene

(5) Drugs for ILKAP Gene - From: PharmGKB and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Hydrochlorothiazide Approved, Vet_approved Pharma Inhibition, Inhibitor 413
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Manganese Approved Nutra 34
Magnesium Nutra 0
genes like me logo Genes that share compounds with ILKAP: view

Transcripts for ILKAP Gene

Unigene Clusters for ILKAP Gene

Integrin-linked kinase-associated serine/threonine phosphatase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ILKAP

Alternative Splicing Database (ASD) splice patterns (SP) for ILKAP Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b · 5c · 5d ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11a · 11b ^ 12a · 12b ^ 13a · 13b
SP1: - - - - - - -
SP2: - - - - - -
SP3: -
SP4: - -
SP5: -
SP6:
SP7: -
SP8: -

Relevant External Links for ILKAP Gene

GeneLoc Exon Structure for
ILKAP
ECgene alternative splicing isoforms for
ILKAP

Expression for ILKAP Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ILKAP Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ILKAP Gene

This gene is overexpressed in Peripheral blood mononuclear cells (13.5), Lymph node (7.8), and Breast (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ILKAP Gene



Protein tissue co-expression partners for ILKAP Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of ILKAP Gene:

ILKAP

SOURCE GeneReport for Unigene cluster for ILKAP Gene:

Hs.92033

mRNA Expression by UniProt/SwissProt for ILKAP Gene:

Q9H0C8-ILKAP_HUMAN
Tissue specificity: Widely expressed. Highest levels expressed in striated muscle. Much lower levels evident in various smooth muscle tissues.

Evidence on tissue expression from TISSUES for ILKAP Gene

  • Nervous system(2.4)
genes like me logo Genes that share expression patterns with ILKAP: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for ILKAP Gene

Orthologs for ILKAP Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ILKAP Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ILKAP 34 35
  • 99.74 (n)
dog
(Canis familiaris)
Mammalia ILKAP 34 35
  • 92.58 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ILKAP 35
  • 90 (a)
OneToOne
cow
(Bos Taurus)
Mammalia ILKAP 34 35
  • 89.52 (n)
rat
(Rattus norvegicus)
Mammalia Ilkap 34
  • 89.37 (n)
mouse
(Mus musculus)
Mammalia Ilkap 34 16 35
  • 89.29 (n)
oppossum
(Monodelphis domestica)
Mammalia ILKAP 35
  • 85 (a)
OneToOne
chicken
(Gallus gallus)
Aves ILKAP 34 35
  • 77.72 (n)
lizard
(Anolis carolinensis)
Reptilia ILKAP 35
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ilkap 34
  • 65.79 (n)
zebrafish
(Danio rerio)
Actinopterygii zgc:162985 34
  • 63.76 (n)
ILKAP 35
  • 63 (a)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea F33A8.6 34 35
  • 48.8 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PTC1 35
  • 32 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G18030 34
  • 50.44 (n)
rice
(Oryza sativa)
Liliopsida Os09g0314400 34
  • 49.2 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.5800 35
  • 51 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5410 34
Species where no ortholog for ILKAP was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ILKAP Gene

ENSEMBL:
Gene Tree for ILKAP (if available)
TreeFam:
Gene Tree for ILKAP (if available)

Paralogs for ILKAP Gene

Paralogs for ILKAP Gene

(3) SIMAP similar genes for ILKAP Gene using alignment to 5 proteins:

genes like me logo Genes that share paralogs with ILKAP: view

Variants for ILKAP Gene

Sequence variations from dbSNP and Humsavar for ILKAP Gene

SNP ID Clin Chr 02 pos Sequence Context AA Info Type
rs1000036370 -- 238,181,200(+) AGAAA(C/T)TACAC intron-variant
rs1000139261 -- 238,201,967(+) CACCT(A/G)TAATC intron-variant
rs1000189292 -- 238,187,109(+) TTAGC(C/T)GGCTG intron-variant
rs1000195197 -- 238,180,891(+) GAAGA(A/G)GTGAT intron-variant
rs1000252295 -- 238,196,498(+) CTGGG(-/ATTAC)AGGTA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ILKAP Gene

Variant ID Type Subtype PubMed ID
dgv7348n54 CNV loss 21841781
esv3594756 CNV loss 21293372
nsv1000252 CNV loss 25217958
nsv1073028 CNV deletion 25765185
nsv1112783 CNV deletion 24896259
nsv460147 CNV loss 19166990
nsv470525 CNV loss 18288195
nsv478820 CNV novel sequence insertion 20440878
nsv508894 CNV insertion 20534489
nsv517412 CNV loss 19592680

Variation tolerance for ILKAP Gene

Residual Variation Intolerance Score: 28.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.59; 12.61% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ILKAP Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ILKAP

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ILKAP Gene

Disorders for ILKAP Gene

Relevant External Links for ILKAP

Genetic Association Database (GAD)
ILKAP
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ILKAP

No disorders were found for ILKAP Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ILKAP Gene

Publications for ILKAP Gene

  1. ILKAP regulates ILK signaling and inhibits anchorage-independent growth. (PMID: 14990992) Kumar A.S. … Hannigan G.E. (Oncogene 2004) 3 4 22 64
  2. Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations. (PMID: 22359512) Demirkan A. … Schmitz G. (PLoS Genet. 2012) 3 46 64
  3. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen J.V. … Mann M. (Cell 2006) 3 4 64
  4. Generation and annotation of the DNA sequences of human chromosomes 2 and 4. (PMID: 15815621) Hillier L.W. … Wilson R.K. (Nature 2005) 3 4 64
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64

Products for ILKAP Gene

  • Addgene plasmids for ILKAP

Sources for ILKAP Gene

Content
Loading form....