Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

HPRT1 Gene

protein-coding   GIFtS: 69
GCID: GC0XP133594

hypoxanthine phosphoribosyltransferase 1


(Previous symbol: HPRT)
 Explore 107 diseases affiliated with
HPRT1 via our new
 Human Malady Compendium 
Biological research products
for HPRT1
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Hypoxanthine Phosphoribosyltransferase 11 2
HPRT1 2 3 5
HGPRT1 2 3
HGPRTase2 3
EC 2.4.2.83 8
Hypoxanthine-Guanine Phosphoribosyltransferase2

External Ids:    HGNC: 51571   Entrez Gene: 32512   Ensembl: ENSG000001657047   OMIM: 3080005   UniProtKB: P004923   

Export aliases for HPRT1 gene to outside databases

Previous GC identifers: GC0XP128239 GC0XP130440 GC0XP131539 GC0XP132299 GC0XP133319 GC0XP133421 GC0XP122992


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for HPRT1:
The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate
and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl
1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage
pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.(provided by RefSeq, Jun 2009)

UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492
Function: Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the
5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of
purine nucleotides through the purine salvage pathway

Gene Wiki entry for HPRT1 (Hypoxanthine-guanine phosphoribosyltransferase)


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000023.10  NC_018934.1  NT_011786.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the HPRT1 gene promoter:
         p53   Nkx2-2   POU6F1 (c2)   AP-2gamma   NF-kappaB   FOXL1   POU2F1   NF-kappaB2   POU2F1a   NF-kappaB1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidHPRT1 promoter sequence
   Search SABiosciences Chromatin IP Primers for HPRT1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HPRT1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: Xq26.1   Ensembl cytogenetic band:  Xq26.2   HGNC cytogenetic band: Xq26.2

HPRT1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
HPRT1 gene location

GeneLoc information about chromosome X         GeneLoc Exon Structure

GeneLoc location for GC0XP133594:  view genomic region     (about GC identifiers)

Start:
133,594,175 bp from pter      End:
133,654,543 bp from pter
Size:
60,369 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492 (See protein sequence)
Recommended Name: Hypoxanthine-guanine phosphoribosyltransferase  
Size: 218 amino acids; 24579 Da
Cofactor: Binds 2 magnesium ions per subunit. The magnesium ions are essentially bound to the substrate and have few
direct interactions with the protein
Subunit: Homotetramer
Subcellular location: Cytoplasm
6/8 PDB 3D structures from and Proteopedia for HPRT1 (see all 8):
1BZY (3D)        1D6N (3D)        1HMP (3D)        1Z7G (3D)        2VFA (3D)        3GEP (3D)    
Secondary accessions: A6NHF0 B2R8M9

Explore the universe of human proteins at neXtProt for HPRT1: NX_P00492

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P00492

  • 11 DME Specific Peptides for HPRT1 (P00492) (see first 4)
     VLIVEDI  LIVEDIID  CVISETGK  VEDIIDTG 
     GYDLDLFCIP  KSYCNDQSTG  FVVGYALDYN  VKVASLLVKRT 
     FRDLNHVCVISE  IPHGLIMDRTERLAR  MGGHHIVALCVLKGGYKFFADLLDYIKALNRNSD 

    HPRT1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_000185.1  
    ENSEMBL proteins: 
     ENSP00000298556  
    Reactome Protein details: P00492
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein: HPRT1
    OriGene Protein Over-expression Lysate: HPRT1
    OriGene Custom Protein Services for HPRT1 
    GenScript Custom Purified and Recombinant Proteins Services for HPRT1
    Novus Biologicals HPRT1 Proteins
    Novus Biologicals HPRT1 Lysates
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for HPRT1
    Uscn Proteins for HPRT1

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005625soluble fraction ----
    GO:0005737cytoplasm IDA--
    GO:0005829cytosol TAS--


    HPRT1 for ontologies           About GeneDecksing



    HPRT1 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    OriGene Antibodies (see all 2): HPRT1
    OriGene Custom Antibody Services for HPRT1 
    GenScript Superior Antibodies for HPRT1
    Novus Biologicals HPRT1 Antibodies
    Abcam antibodies for HPRT1 
    Uscn Antibodies for HPRT1
    ThermoFisher Antibody for HPRT1

    Assay Products for HPRT1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for HPRT1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for HPRT1


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    HPRT1 for domains           About GeneDecksing

    2 InterPro domains/families:
     IPR005904 Hxn_phspho_trans
     IPR000836 PRibTrfase_dom

    Graphical View of Domain Structure for InterPro Entry P00492

    ProtoNet protein and cluster: P00492

    1 Blocks protein family: IPB002375 Purine/pyrimidine phosphoribosyl transferase

    UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492
    Similarity: Belongs to the purine/pyrimidine phosphoribosyltransferase family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492
    Function: Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the
    5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of
    purine nucleotides through the purine salvage pathway
    Catalytic activity: IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate
    Catalytic activity: GMP + diphosphate = guanine + 5-phospho-alpha-D-ribose 1-diphosphate
    Biophysicochemical properties: Kinetic parameters: KM=5.4 uM for IMP; KM=0.45 uM for hypoxanthine; KM=25 uM for
    pyrophosphate; KM=31 uM for phosphoribosylpyrophosphate;

         Genatlas biochemistry entry for HPRT1:
    hypoxanthine phosphoribosyltransferase,purine salvage pathway

    Enzyme Number (IUBMB): EC 2.4.2.81 2

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: HPRT1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HPRT1
    8/9 QIAGEN miScript miRNA Assays for microRNAs that regulate HPRT1 (see all 9):
    hsa-miR-301b hsa-miR-301a hsa-miR-3666 hsa-miR-19b hsa-miR-4295 hsa-miR-454 hsa-miR-130a hsa-miR-19a
    SwitchGear 3'UTR luciferase reporter plasmidHPRT1 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HPRT1
    OriGene shRNA RFP: HPRT1
    OriGene siRNA: HPRT1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HPRT1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for HPRT1

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1 (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: HPRT1 (NM_000194)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HPRT1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HPRT1 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for HPRT1
    Search LifeMap BioReagents cell lines for HPRT1

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HPRT1

    Gene Ontology (GO): 5/7 molecular function terms (GO ID links to tree view) (see all 7):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000166nucleotide binding IEA--
    GO:0000287magnesium ion binding IDA10360366
    GO:0004422hypoxanthine phosphoribosyltransferase activity IDA19527031
    GO:0005515protein binding IPI19060904
    GO:0042802identical protein binding ----


    HPRT1 for ontologies           About GeneDecksing


    Animal Models:
         Mouse knock-out Hprttm1.1Pobe for HPRT1
         15/25 MGI mutant phenotypes (inferred from 121 alleles(MGI details for Hprt) (see all 25):
     behavior/neurological  cardiovascular system  cellular  craniofacial  digestive/alimentary 
     embryogenesis  endocrine/exocrine gland  growth/size  hearing/vestibular/ear  hematopoietic system 
     homeostasis/metabolism  immune system  integument  liver/biliary system  mortality/aging 

    HPRT1 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/8 super-pathways (see all 8About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Purine metabolism
    Purine metabolism1.00
    Purine salvage0.39
    Metabolism of nucleotides0.42
    2Metabolism
    Metabolism1.00
    Metabolic pathways0.38
    3adenine and adenosine salvage III
    adenine and adenosine salvage III1.00
    guanine and guanosine salvage I0.50
    4ATP/ITP metabolism
    ATP/ITP metabolism1.00
    ATP/ITP metabolism0.98
    5Nucleotide Metabolism
    Nucleotide Metabolism1.00

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for HPRT1
        ATP/ITP metabolism


    1 GeneGo (Thomson Reuters) Pathway for HPRT1
        ATP/ITP metabolism

    3 BioSystems Pathways for HPRT1 
        adenine and adenosine salvage III
    Nucleotide Metabolism
    guanine and guanosine salvage I

    4        Reactome Pathways for HPRT1
        Metabolism of nucleotides
    Metabolism
    Purine salvage
    Purine metabolism

    1 PharmGKB Pathway for HPRT1
        Thiopurine Pathway, Pharmacokinetics/Pharmacodynamics

    3         Kegg Pathways  (Kegg details for HPRT1):
        Purine metabolism
    Drug metabolism - other enzymes
    Metabolic pathways

    UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492
    Pathway: Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1


    HPRT1 for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for HPRT1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/97 Interacting proteins for HPRT1 (P004921, 2, 3 ENSP000002985564) via UniProtKB, MINT, STRING, and/or I2D (see all 97)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    WDYHV1Q96HA81, 2, 3, ENSP000002873874EBI-748210,EBI-741158 MINT-67224 I2D: score=5 STRING: ENSP00000287387
    PRTFDC1Q9NRG12, 3, ENSP000003186024MINT-68331 I2D: score=5 STRING: ENSP00000318602
    HUS1O609213, ENSP000002587744I2D: score=2 STRING: ENSP00000258774
    FANCAO153603, ENSP000003739524I2D: score=1 STRING: ENSP00000373952
    UBCP0CG483, ENSP000003448184I2D: score=1 STRING: ENSP00000344818
    About this table

    Gene Ontology (GO): 5/28 biological process terms (GO ID links to tree view) (see all 28):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0001975response to amphetamine IEA--
    GO:0006144purine nucleobase metabolic process TAS--
    GO:0006164purine nucleotide biosynthetic process IMP9824441
    GO:0006166purine ribonucleoside salvage IMP9824441
    GO:0006168adenine salvage IBA--


    HPRT1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    HPRT1 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for HPRT1

    10/12 HMDB Compounds for HPRT1 (see all 12)    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenine1,6-Dihydro-6-iminopurine (see all 19)73-24-5--
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    GuanineGUN (see all 26)73-40-5--
    Guanosine monophosphate5'-GMP (see all 14)85-32-5--
    Hypoxanthine1,7-Dihydro-6H-purin-6-one (see all 20)68-94-0--
    Inosinic acid5'-IMP (see all 9)131-99-7--
    MagnesiumMagnesium (see all 2)7439-95-4--
    Phosphoribosyl pyrophosphate5-Phospho-a-D-ribose-1-diphosphate (see all 37)7540-64-9--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--

    8 DrugBank Compounds for HPRT1    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    Thioguanine2-Amino 6MP (see all 14)154-42-7enzymesubstrate14529546 11545274 15136753 11756148 1383700
    3h-Pyrazolo[4,3-D]Pyrimidin-7-Ol-- --target--17139284 17016423 10592235
    5--Monophosphate-9-Beta-D-Ribofuranosyl Xanthine-- --target--17139284 17016423 10592235
    9-Deazaguanine-- --target--17139284 17016423 10592235
    Alpha-Phosphoribosylpyrophosphoric Acid-- 13270-65-0target--17139284 17016423 10592235
    Pyrophosphate 2--- --target--17139284 17016423 10592235
    AzathioprineAzathioprin (see all 4)446-86-6targetinhibitor18020555 15354273
    Mercaptopurine6 MP (see all 5)50-44-2targetinhibitor15354273

    10/126 Novoseek chemical compound relationships for HPRT1 gene (see all 126)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    hypoxanthine 93.4 273 17129743 (3), 2397107 (2), 8824508 (2), 10657589 (2) (see all 99)
    6 thioguanine 91.5 152 9262380 (5), 7681532 (4), 9855005 (3), 17066413 (3) (see all 84)
    purine 83.3 130 1311306 (3), 12429535 (2), 10850548 (2), 9824441 (2) (see all 88)
    prpp 80.6 48 1311306 (4), 10657589 (3), 18536021 (2), 15819884 (2) (see all 19)
    actb 78.1 24 16777070 (3), 15720708 (3), 18191039 (2), 17257226 (2) (see all 15)
    guanine 74.6 71 1850982 (2), 8589681 (2), 8962428 (2), 10576552 (2) (see all 52)
    1,3-butadiene 74.5 57 11397407 (5), 11397400 (4), 15036120 (4), 18288319 (3) (see all 22)
    1-nitrosopyrene 73 5 9202750 (1), 8033153 (1), 7592980 (1), 8668188 (1)
    butadiene monoxide 72.5 9 8070866 (2), 8149485 (2), 9379915 (1), 9463556 (1) (see all 5)
    bpde 71.8 41 1381465 (4), 2120584 (3), 2122466 (3), 9202750 (2) (see all 16)

    1 PharmGKB related drug/compound annotation for HPRT1 gene
    Drug/compound PharmGKB Annotation
    mycophenolic acidDL  
    About this table

    Search CenterWatch for drugs/clinical trials and news about HPRT1 / HPRT 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for HPRT1 gene: 
    NM_000194.2  

    Unigene Cluster for HPRT1:

    Hypoxanthine phosphoribosyltransferase 1
    Hs.412707  [show with all ESTs]
    Unigene Representative Sequence: NM_000194
    3 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000298556(uc004exl.4) ENST00000462974 ENST00000475720

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: HPRT1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HPRT1
    8/9 QIAGEN miScript miRNA Assays for microRNAs that regulate HPRT1 (see all 9):
    hsa-miR-301b hsa-miR-301a hsa-miR-3666 hsa-miR-19b hsa-miR-4295 hsa-miR-454 hsa-miR-130a hsa-miR-19a
    SwitchGear 3'UTR luciferase reporter plasmidHPRT1 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HPRT1
    OriGene shRNA RFP: HPRT1
    OriGene siRNA: HPRT1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HPRT1
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1 (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: HPRT1 (NM_000194)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HPRT1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HPRT1 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HPRT1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat HPRT1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HPRT1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HPRT1

    Additional cDNA sequence: 

    AK313435.1 BC000578.2 BT019350.1 CR407645.1 L29382.1 L29383.1 M24772.1 M31642.1 
    U31737.1 

    7 DOTS entries:

    DT.315146  DT.101982197  DT.95182310  DT.121305200  DT.92441189  DT.100800735  DT.99955125 

    24/275 AceView cDNA sequences (see all 275):

    BF725707 BM968309 AV713164 CB158613 BE218846 CA419764 CA418043 BQ774854 
    BM665410 AA320916 N47311 BM315030 BQ772821 AV648680 BE548220 BX281515 
    CR614617 AI990397 AI246714 BM712509 H06322 AW949523 T28613 BG216143 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    HPRT1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TATCTTCTAA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See HPRT1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for HPRT1

    SOURCE GeneReport for Unigene cluster: Hs.412707
        SABiosciences Expression via Pathway-Focused PCR Arrays including HPRT1 (see all 149): 
              Antiviral Response in human mouse rat
              Multiple Sclerosis in human mouse rat
              Wound Healing in human mouse rat
              Prostate Cancer in human mouse rat
              Drug Metabolism: Phase I Enzymes in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HPRT1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat HPRT1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HPRT1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HPRT1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HPRT1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the last universal common ancestor (LUCA).

    Orthologs for HPRT1 gene from 8/29 species (see all 29)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves HPRT11 hypoxanthine phosphoribosyltransferase 1 81.04(n)
    90.83(a)
      395653  NM_204848.1  NP_990179.1 
    lizard
    (Anolis carolinensis)
    Reptilia HPRT16
    --
    91(a)
    1 ↔ 1
    GL343761.1(177239-186016)
    tropical clawed frog
    (Xenopus tropicalis)
    Amphibia MGC762232 hypothetical protein MGC76223 79.79(n)    BC064242.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.16682 Danio rerio cDNA clone MGC56221 IMAGE5600947, complete more 78.57(n)    BC046003.1 
    worm
    (Caenorhabditis elegans)
    Secernentea Y105E8B.53
    CELE_Y105E8B.51
    Protein Y105E8B.51 48(a)3
    51.89(n)1
    49.06(a)1
      I(14665437-14669289)3
    1733231  NM_061144.41  NP_493545.11 
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons HGPT6
    hypoxanthine phosphoribosyltransferase
    31(a)
    possible ortholog
    1(26987775-26989199)
    rice
    (Oryza sativa)
    Liliopsida --
    phosphoribosyl transferase, putative, expressed
    21(a)
    possible ortholog
    5(4947656-4951852)
    E. coli
    (Escherichia coli)
    Gamma proteobacteria hpt6
    hypoxanthine phosphoribosyltransferase
    33(a)
    possible ortholog
    Chromosome(141431-141967)


    ENSEMBL Gene Tree for HPRT1 (if available)
    TreeFam Gene Tree for HPRT1 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for HPRT1 gene
    PRTFDC12  
    1 SIMAP similar gene for HPRT1 using alignment to 2 protein entries:     HPRT_HUMAN (see all proteins):
    PRTFDC1

    HPRT1 for paralogs           About GeneDecksing


    3 Pseudogenes.org Pseudogenes for HPRT1
    PGOHUM00000242429 PGOHUM00000245472 PGOHUM00000235542


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/571 NCBI SNPs in HPRT1 are shown (see all 571    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr X posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1378524941,2
    Cpathogenic133609227(+) TTGCTC/G/TGAGAT 3 R G * mis1 stg10--------
    rs1870298511,2
    --133592263(+) GCAAAA/GTTATT 1 -- us2k10--------
    rs590978361,2
    C,--133592277(+) GAACAC/TGTAAC 1 -- us2k11Minor allele frequency- T:0.50WA 2
    rs1918739511,2
    --133592431(+) TGCCCA/GAAGTC 1 -- us2k10--------
    rs178823581,2
    F--133592464(+) CCCAGG/TATTTG 1 -- us2k11Minor allele frequency- T:0.01NS 176
    rs1841661671,2
    --133592502(+) TTTCCA/CTTACA 1 -- us2k10--------
    rs178847751,2
    C,F,--133592565(+) GGACTT/GCACAA 1 -- us2k18Minor allele frequency- G:0.03NS WA 842
    rs1867292081,2
    --133592693(+) CAGTAA/GTTATT 1 -- us2k10--------
    rs1996069531,2
    --133592924(+) CAGGT-/TTATTATT 1 -- us2k10--------
    rs596536531,2
    C,--133592967(+) AGAGAA/TGCTCA 1 -- us2k10--------

    HapMap Linkage Disequilibrium report for HPRT1 (133594175 - 133654543 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for HPRT1: --
    Human Gene Mutation Database (HGMD): HPRT1

    Locus Specific Mutation Databases (LSDB): HPRT1

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing HPRT1
    DNA2.0 Custom Variant and Variant Library Synthesis for HPRT1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    HPRT1 for disorders           About GeneDecksing

    OMIM gene information: 308000   
    OMIM disorders: 300322  300323  
    UniProtKB/Swiss-Prot: HPRT_HUMAN, P00492
  • Defects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete
  • lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive
    self-mutilation
  • Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout
  • or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia

    20/107 diseases for HPRT1 (see all 107):    About MalaCards
    lesch-nyhan syndrome    gout    phosphoribosylpyrophosphate synthetase superactivity    purine nucleoside phosphorylase deficiency
    nucleoside phosphorylase deficiency    hprt-related gout    adenine phosphoribosyltransferase deficiency    paroxysmal nocturnal hemoglobinuria
    macular holes    down syndrome critical region    hyperuricemic nephropathy    tropical spastic paraparesis
    xeroderma pigmentosum    acute urate nephropathy    spastic paraparesis    developmental disabilities
    hypouricemia    choreoathetosis    retinal detachment    non-hodgkin lymphoma

    7 diseases from the University of Copenhagen DISEASES database for HPRT1:
    Lesch-Nyhan syndrome     Hyperuricemia     DOID:13189     Purine nucleoside phosphorylase deficiency
    N syndrome     Intellectual disability     Nephrolithiasis

    10/92 Novoseek disease relationships for HPRT1 gene (see all 92)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    lesch-nyhan syndrome 97.1 433 11307586 (10), 17309125 (7), 15935074 (6), 9629791 (5) (see all 99)
    hprt deficiency, partial 95.1 75 16649740 (3), 17065067 (3), 8028417 (2), 11773585 (2) (see all 37)
    hyperuricemia 78.4 46 2018042 (2), 16216473 (2), 12508781 (2), 7987318 (1) (see all 29)
    somatic mutations 73.3 47 8824508 (2), 11673087 (2), 9435878 (2), 7521002 (2) (see all 31)
    choreoathetosis 72.6 6 15193365 (1), 11307586 (1), 12927681 (1), 1487231 (1) (see all 6)
    purine metabolism disorder 71.5 4 2018042 (1), 1912725 (1), 17065067 (1)
    gout 68.3 49 8112742 (3), 1306134 (2), 10451080 (2), 15862284 (2) (see all 29)
    arthritis gouty 65.1 8 19565499 (2), 15158715 (1), 15193365 (1), 15862284 (1) (see all 6)
    chromosomal aberrations 63.1 49 1879404 (3), 8143603 (2), 1719390 (2), 7523909 (2) (see all 39)
    xeroderma pigmentosum 60.6 7 9379920 (2), 1992158 (1), 7683756 (1), 1372100 (1) (see all 5)

    Genatlas disease: HPRT1
    Lesch Nyhan syndrome,including severe juvenile gout

    GeneTests: HPRT1
    Lesch-Nyhan Syndrome

    Genetic Association Database (GAD): HPRT1
    Human Genome Epidemiology (HuGE) Navigator: HPRT1 (13 documents)

    Export disorders for HPRT1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for HPRT1 gene, integrated from 9 sources (see all 1001):
    (articles sorted by number of sources associating them with HPRT1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. A review of the molecular basis of hypoxanthine-guanine phosphoribosyltransferase (HPRT) deficiency. (PubMed id 1487231)1, 2, 9 Sculley D.G.... Gordon R.B. (1992)
    2. Characterization of mutations in phenotypic variants of hypoxanthine phosphoribosyltransferase deficiency. (PubMed id 1301916)1, 2, 9 Sege-Paterson K.... Nyhan W.L. (1992)
    3. Hypoxanthine-guanine phosphoribosyltransferase deficiency: analysis of HPRT mutations by direct sequencing and allele-specific amplification. (PubMed id 1937471)1, 2, 9 Sculley D.G.... Gordon R.B. (1991)
    4. Identification of 17 independent mutations responsible for human hypoxanthine-guanine phosphoribosyltransferase (HPRT) deficiency. (PubMed id 2018042)1, 2, 9 Davidson B.L.... Palella T.D. (1991)
    5. Differential interactions between GSTM1 and NAT2 genotypes on aromatic DNA adduct level and HPRT mutant frequency in lung cancer patients and population controls. (PubMed id 11219770)1, 4, 9 Hou S.M....Lambert B. (2001)
    6. Ternary complex structure of human HGPRTase, PRPP, Mg2+, and the inhibitor HPP reveals the involvement of the flexible loop in substrate binding. (PubMed id 10338013)1, 2, 9 Balendiran G.K.... Craig S.P. III (1999)
    7. An asymptomatic germline missense base substitution in the hypoxanthine phosphoribosyltransferase (HPRT) gene that reduces the amount of enzyme in humans. (PubMed id 9003484)1, 2, 9 Fujimori S....Kamatani N. (1997)
    8. The crystal structure of human hypoxanthine-guanine phosphoribosyltransferase with bound GMP. (PubMed id 8044844)1, 2, 9 Eads J.C.... Sacchettini J.C. (1994)
    9. The crystal structure of free human hypoxanthine-guanine phosphoribosyltransferase reveals extensive conformational plasticity throughout the catalytic cycle. (PubMed id 15990111)1, 2, 9 Keough D.T....Guddat L.W. (2005)
    10. Differences in HPRT mutant frequency among middle-aged Flemish women in association with area of residence and blood lead levels. (PubMed id 15204312)1, 4, 9 Van Larebeke N....Kleinjans J. (2004)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 3251 HGNC: 5157 AceView: HPRT1 Ensembl:ENSG00000165704 euGenes: HUgn3251
    ECgene: HPRT1 Kegg: 3251 H-InvDB: HPRT1

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for HPRT1 Pharmacogenomics, SNPs, Pathways
    GeneReviewshttp://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/HPRT1
    NIEHS-SNPshttp://egp.gs.washington.edu/data/hprt1/
    Wikipedia http://en.wikipedia.org/wiki/Hypoxanthine-guanine_phosphoribosyltransferase

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for HPRT1 gene:
    Search GeneIP for patents involving HPRT1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for HPRT1   OriGene shRNA RFP for HPRT1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HPRT1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HPRT1  
     OriGene Protein Over-expression Lysate for HPRT1   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for HPRT1   OriGene 3'-UTR Clone for HPRT1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HPRT1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for HPRT1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for HPRT1   OriGene Custom Protein Services for HPRT1  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat HPRT1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing HPRT1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HPRT1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HPRT1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HPRT1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HPRT1
     GenScript Custom Purified and Recombinant Proteins Services for HPRT1 GenScript cDNA clones with any tag delivered in your preferred vector for HPRT1
     GenScript Custom Assay Services for HPRT1 GenScript Superior Antibodies for HPRT1
     GenScript Custom overexpressing Cell Line Services for HPRT1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in HPRT1 promoter
     Search Chromatin IP Primers for HPRT1
     RT2 qPCR Primer Assay in human, mouse, rat HPRT1
     Search GNC Networks for HPRT1
     SABiosciences PCR Arrays including human, mouse, rat HPRT1
     Search Tocris compounds for HPRT1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     HPRT1 antibodies
     HPRT1 proteins
     HPRT1 lysates
     Antibodies for HPRT1
     See all of Abcam's Antibodies, Kits and Proteins for HPRT1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for HPRT1




     HPRT1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for HPRT1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HPRT1
     SwitchGear 3'UTR luciferase reporter plasmids for HPRT1
     SwitchGear Promoter luciferase reporter plasmids for HPRT1
     ThermoFisher Antibody for HPRT1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HPRT1
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      HPRT1 gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4