Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HK2 Gene

Aliases for HK2 Gene

  • Hexokinase 2 2 3 5
  • Muscle Form Hexokinase 3 4
  • Hexokinase Type II 3 4
  • EC 2.7.1.1 4 61
  • HK II 3 4
  • Hexokinase-2, Muscle 3
  • Hexokinase-2 3
  • EC 2.7.1 61
  • HKII 3
  • HXK2 3

External Ids for HK2 Gene

Previous GeneCards Identifiers for HK2 Gene

  • GC02P075198
  • GC02P075018
  • GC02P075035
  • GC02P075034
  • GC02P074971
  • GC02P075059

Summaries for HK2 Gene

Entrez Gene Summary for HK2 Gene

  • Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]

GeneCards Summary for HK2 Gene

HK2 (Hexokinase 2) is a Protein Coding gene. Diseases associated with HK2 include Pediatric Osteosarcoma and Chondroblastoma. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Type II diabetes mellitus. GO annotations related to this gene include phosphotransferase activity, alcohol group as acceptor and fructokinase activity. An important paralog of this gene is HK1.

Tocris Summary for HK2 Gene

  • Hexokinases catalyze the first essential step of glucose metabolism, the conversion of the substrate glucose into glucose-6-phosphate. This phosphorylation event directly couples extramitochondrial glycolysis to intramitochondrial oxidative phosphorylation.

Gene Wiki entry for HK2 Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HK2 Gene

Genomics for HK2 Gene

Regulatory Elements for HK2 Gene

Enhancers for HK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH02G074872 1.6 FANTOM5 Ensembl ENCODE dbSUPER 49.8 +41.8 41773 4.5 CTCF PKNOX1 FEZF1 CEBPG RAD21 GATA3 SCRT2 SMC3 FOS ZNF263 HK2 M1AP SEMA4F MTHFD2 LBX2 GC02P074877 GC02M074860
GH02G074842 1.9 FANTOM5 Ensembl ENCODE dbSUPER 40.6 +14.9 14949 10.0 FOXA2 ZFP64 ARID4B SIN3A GATA2 FOS DEK ZHX2 JUNB PPARG HK2 SEMA4F M1AP ENSG00000236209 LINC01293 LBX2 GC02M074813 GC02M074860
GH02G074831 1.6 FANTOM5 ENCODE dbSUPER 15.1 +2.3 2258 6.7 HDGF PKNOX1 FOXA2 CREB3L1 WRNIP1 ARID4B SIN3A FEZF1 DMAP1 SLC30A9 HK2 BOLA3-AS1 PIR31548 GC02M074833 GC02P074837
GH02G074714 1.3 Ensembl ENCODE 11.8 -117.2 -117248 1.6 PKNOX1 ATF1 CREB3L1 ARID4B SIN3A DMAP1 ZNF2 ZNF48 SLC30A9 GLIS2 HK2 SEMA4F M1AP INO80B LBX2-AS1 LOC102724497 RPS28P5
GH02G074777 1.1 Ensembl ENCODE 12.4 -54.2 -54205 1.8 FOXA2 ARNT ZFP64 ARID4B YBX1 BMI1 RAD21 ZNF48 RARA ETV6 HK2 LOC102724482 RPS28P5
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around HK2 on UCSC Golden Path with GeneCards custom track

Genomic Location for HK2 Gene

Chromosome:
2
Start:
74,832,655 bp from pter
End:
74,893,359 bp from pter
Size:
60,705 bases
Orientation:
Plus strand

Genomic View for HK2 Gene

Genes around HK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HK2 Gene

Proteins for HK2 Gene

  • Protein details for HK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P52789-HXK2_HUMAN
    Recommended name:
    Hexokinase-2
    Protein Accession:
    P52789
    Secondary Accessions:
    • D6W5J2
    • Q8WU87
    • Q9UN82

    Protein attributes for HK2 Gene

    Size:
    917 amino acids
    Molecular mass:
    102380 Da
    Quaternary structure:
    • Monomer (By similarity). Interacts with TIGAR; the interaction increases hexokinase HK2 activity in a hypoxia- and HIF1A-dependent manner (PubMed:23185017).
    Miscellaneous:
    • In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase).

    Three dimensional structures from OCA and Proteopedia for HK2 Gene

neXtProt entry for HK2 Gene

Selected DME Specific Peptides for HK2 Gene

P52789:
  • DIRTEFD
  • MRLSDETL
  • PDGTEKG
  • EWGAFGD
  • TMMTCGY
  • GFTFSFP
  • QVQKVDQ
  • RIKENKGEERLRSTIGVDGSVYKKHPHFAKRL
  • CQIVSTRSASLCAATLAAVL
  • RAAQLCGAG
  • DPTQEDCVATHR
  • IKDKKLP
  • LYHMRLSD
  • LIRKAIQRRGDFDIDIVA
  • GVDGSVYK
  • TGRFETKD
  • CGAGMAA
  • GFTFSFPC
  • NACYMEE
  • ATTHPTA
  • DGSGKGAA
  • LDLGGTNFRV
  • AMVTAVA
  • SILLKWTKGFKASGCEGEDVVTLLKEAI
  • VNDTVGTMM
  • VGVDGTLYKLHP
  • TRGIFETKFLSQIESD
  • YLGEIVRNILIDFTK
  • GLIVGTG
  • SLNPGKQ
  • EGRMCVN
  • QTKLDESFLVSWTKGFKS
  • GELVRLIL
  • HLGLESTC
  • VEMHNKIY
  • LPLGFTFS
  • NMEWGAFGDNGC
  • MCINMEWGAFGD
  • GSGTQLFDH
  • RICQIVS
  • ALDLGGTN
  • ELFDHIVQCIADFL
  • AVDELSLN
  • VKMLPTFVR
  • GKLSPELL
  • SGMYLGEI
  • GLSKETHA

Post-translational modifications for HK2 Gene

  • Ubiquitination at isoforms=41, posLast=6262, posLast=173173, isoforms=323, isoforms=488, and posLast=899899
  • Modification sites at PhosphoSitePlus

Other Protein References for HK2 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for HK2 (HK2)

Domains & Families for HK2 Gene

Protein Domains for HK2 Gene

Suggested Antigen Peptide Sequences for HK2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P52789

UniProtKB/Swiss-Prot:

HXK2_HUMAN :
  • The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus. Each domain can bind a single glucose and Gluc-6-P molecule.
  • Belongs to the hexokinase family.
Domain:
  • The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus. Each domain can bind a single glucose and Gluc-6-P molecule.
Family:
  • Belongs to the hexokinase family.
genes like me logo Genes that share domains with HK2: view

No data available for Gene Families for HK2 Gene

Function for HK2 Gene

Molecular function for HK2 Gene

GENATLAS Biochemistry:
hexokinase 2,108kDa,muscle and fat tissues,glycolysis,gluconeogenesis,energy pathways
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + D-hexose = ADP + D-hexose 6-phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Hexokinase is an allosteric enzyme inhibited by its product Glc-6-P.

Enzyme Numbers (IUBMB) for HK2 Gene

Gene Ontology (GO) - Molecular Function for HK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004340 glucokinase activity TAS --
GO:0004396 hexokinase activity TAS,IEA 9278438
GO:0005515 protein binding IPI 16189514
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with HK2: view
genes like me logo Genes that share phenotypes with HK2: view

Animal Models for HK2 Gene

MGI Knock Outs for HK2:

Animal Model Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HK2 Gene

Localization for HK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HK2 Gene

Mitochondrion outer membrane. Note=Its hydrophobic N-terminal sequence may be involved in membrane binding. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HK2 gene
Compartment Confidence
mitochondrion 5
cytosol 5
nucleus 2
plasma membrane 1
extracellular 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for HK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005623 cell IEA --
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IDA,NAS 18350175
GO:0005829 cytosol TAS --
GO:0016020 membrane IDA,IEA 19946888
genes like me logo Genes that share ontologies with HK2: view

Pathways & Interactions for HK2 Gene

genes like me logo Genes that share pathways with HK2: view

UniProtKB/Swiss-Prot P52789-HXK2_HUMAN

  • Pathway: Carbohydrate metabolism; hexose metabolism.

Gene Ontology (GO) - Biological Process for HK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001678 cellular glucose homeostasis IEA,IBA --
GO:0002931 response to ischemia IEA --
GO:0005975 carbohydrate metabolic process IEA --
GO:0006006 glucose metabolic process IEA --
GO:0006096 glycolytic process IEA,TAS 23962723
genes like me logo Genes that share ontologies with HK2: view

No data available for SIGNOR curated interactions for HK2 Gene

Drugs & Compounds for HK2 Gene

(23) Drugs for HK2 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
D-glucose Approved Pharma 0
Sorbitol Approved Pharma 34
Adenosine triphosphate Approved Nutra 0
Glucosamine Approved Nutra 191
Glucose 6-phosphate Experimental Pharma 0

(27) Additional Compounds for HK2 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Alpha-D-Glucose
  • a-D-Glucopyranose
  • a-D-Glucose
  • a-Dextrose
  • a-Glucose
  • alpha-D-Glucopyranose
492-62-6
Beta-D-Fructose 6-phosphate
  • beta-D-Fructose 6-phosphate
dADP
  • 2'-Deoxyadenosine-5'-diphosphate
  • dADP
  • Deoxyadenosine diphosphate
2793-06-8
D-Fructose
  • beta-D-Arabino-hexulose
  • beta-D-Fructofuranose
  • beta-D-Fructose
  • beta-delta-Arabino-hexulose
  • beta-delta-Fructofuranose
53188-23-1

(1) Tocris Compounds for HK2 Gene

Compound Action Cas Number
GKA 50 Glucokinase activator 851884-87-2

(1) ApexBio Compounds for HK2 Gene

Compound Action Cas Number
Lonidamine 50264-69-2
genes like me logo Genes that share compounds with HK2: view

Transcripts for HK2 Gene

Unigene Clusters for HK2 Gene

Hexokinase 2:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for HK2 Gene

No ASD Table

Relevant External Links for HK2 Gene

GeneLoc Exon Structure for
HK2
ECgene alternative splicing isoforms for
HK2

Expression for HK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HK2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for HK2 Gene

This gene is overexpressed in Whole Blood (x7.0), Muscle - Skeletal (x4.9), and Colon - Transverse (x4.0).

Protein differential expression in normal tissues from HIPED for HK2 Gene

This gene is overexpressed in Brain (14.0), Retina (13.2), Bone (7.6), and Testis (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HK2 Gene



NURSA nuclear receptor signaling pathways regulating expression of HK2 Gene:

HK2

SOURCE GeneReport for Unigene cluster for HK2 Gene:

Hs.406266

mRNA Expression by UniProt/SwissProt for HK2 Gene:

P52789-HXK2_HUMAN
Tissue specificity: Predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle.

Evidence on tissue expression from TISSUES for HK2 Gene

  • Muscle(4.5)
  • Blood(4.3)
  • Heart(2.4)
  • Intestine(2.3)
  • Eye(2.2)
  • Liver(2.2)
  • Nervous system(2.2)
  • Lung(2)
genes like me logo Genes that share expression patterns with HK2: view

Primer Products

No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for HK2 Gene

Orthologs for HK2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HK2 34 35
  • 99.49 (n)
oppossum
(Monodelphis domestica)
Mammalia HK2 35
  • 93 (a)
OneToOne
cow
(Bos Taurus)
Mammalia HK2 34 35
  • 90.44 (n)
dog
(Canis familiaris)
Mammalia HK2 34 35
  • 90.1 (n)
mouse
(Mus musculus)
Mammalia Hk2 34 16 35
  • 87.28 (n)
rat
(Rattus norvegicus)
Mammalia Hk2 34
  • 87.2 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia HK2 35
  • 67 (a)
OneToOne
chicken
(Gallus gallus)
Aves HK2 34 35
  • 80.28 (n)
lizard
(Anolis carolinensis)
Reptilia HK2 35
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC100485269 34
  • 75.62 (n)
zebrafish
(Danio rerio)
Actinopterygii hk2 34 35
  • 72.93 (n)
Dr.10553 34
fruit fly
(Drosophila melanogaster)
Insecta Hex-A 36 35
  • 48 (a)
Hex-C 36 35
  • 45 (a)
Hex-t2 36 35
  • 43 (a)
Hex-t1 36
  • 30 (a)
worm
(Caenorhabditis elegans)
Secernentea F14B4.2 36 34 35
  • 54.12 (n)
H25P06.1 36
  • 39 (a)
Y77E11A.1 36
  • 34 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes GLK1 35
  • 34 (a)
ManyToMany
HXK1 35
  • 34 (a)
ManyToMany
EMI2 35
  • 32 (a)
ManyToMany
HXK2 35
  • 32 (a)
ManyToMany
rice
(Oryza sativa)
Liliopsida Os01g0190400 34
  • 47.94 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.11095 35
  • 50 (a)
OneToMany
Species where no ortholog for HK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HK2 Gene

ENSEMBL:
Gene Tree for HK2 (if available)
TreeFam:
Gene Tree for HK2 (if available)

Paralogs for HK2 Gene

Paralogs for HK2 Gene

(5) SIMAP similar genes for HK2 Gene using alignment to 4 proteins:

Pseudogenes.org Pseudogenes for HK2 Gene

genes like me logo Genes that share paralogs with HK2: view

Variants for HK2 Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for HK2 Gene

HXK2_HUMAN-P52789
Although found in NIDDM patients, genetic variations of HK2 do not contribute to the disease (PubMed:7883122, PubMed:7883123).

Sequence variations from dbSNP and Humsavar for HK2 Gene

SNP ID Clin Chr 02 pos Sequence Context AA Info Type
rs1000000977 -- 74,845,386(+) ATCCC(C/T)CTTTG intron-variant
rs1000034228 -- 74,892,881(+) TCTGC(A/G)CTAAT utr-variant-3-prime
rs1000036793 -- 74,888,176(+) TGGCA(A/T)ACACA intron-variant
rs1000132043 -- 74,870,825(+) AAATG(C/T)TTTGG intron-variant
rs1000145026 -- 74,888,345(+) GCTCA(G/T)AGCAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for HK2 Gene

Variant ID Type Subtype PubMed ID
dgv3871n100 CNV gain 25217958
esv2659874 CNV deletion 23128226
esv2677814 CNV deletion 23128226
esv2751900 CNV gain 17911159
esv2760619 CNV loss 21179565
esv3591289 CNV loss 21293372
esv3591291 CNV loss 21293372
nsv1001495 CNV gain 25217958
nsv1109262 CNV deletion 24896259
nsv1138786 CNV deletion 24896259
nsv518615 CNV gain 19592680
nsv519007 CNV loss 19592680
nsv582217 CNV gain 21841781
nsv829465 CNV loss 20364138
nsv998325 CNV gain 25217958

Variation tolerance for HK2 Gene

Residual Variation Intolerance Score: 37.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 8.44; 85.68% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for HK2 Gene

Human Gene Mutation Database (HGMD)
HK2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
HK2

Disorders for HK2 Gene

MalaCards: The human disease database

(4) MalaCards diseases for HK2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
pediatric osteosarcoma
  • childhood osteosarcoma
chondroblastoma
  • chondroblastoma of bone
diabetes mellitus, noninsulin-dependent
  • diabetes, type 2
hepatocellular carcinoma
  • hepatocellular carcinoma, somatic
- elite association - COSMIC cancer census association via MalaCards
Search HK2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for HK2

Genetic Association Database (GAD)
HK2
Human Genome Epidemiology (HuGE) Navigator
HK2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
HK2
genes like me logo Genes that share disorders with HK2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HK2 Gene

Publications for HK2 Gene

  1. Amino acid substitutions in hexokinase II among patients with NIDDM. (PMID: 7883120) Laakso M. … Deeb S.S. (Diabetes 1995) 3 4 22 46 64
  2. Analysis of the hexokinase II gene in subjects with insulin resistance and NIDDM and detection of a Gln142-->His substitution. (PMID: 7883122) Vidal-Puig A. … Moller D.E. (Diabetes 1995) 3 4 22 46 64
  3. Identification of four amino acid substitutions in hexokinase II and studies of relationships to NIDDM, glucose effectiveness, and insulin sensitivity. (PMID: 7883123) Echwald S.M. … Pedersen O. (Diabetes 1995) 3 4 22 46 64
  4. Human hexokinase II gene: exon-intron organization, mutation screening in NIDDM, and its relationship to muscle hexokinase activity. (PMID: 8786021) Lehto M. … Groop L.C. (Diabetologia 1995) 3 4 22 64
  5. Steady state transcript levels of the type II hexokinase and type 1 glucose transporter in human tumor cell lines. (PMID: 7518342) Shinohara Y. … Terada H. (Cancer Lett. 1994) 3 4 22 64

Products for HK2 Gene

  • Addgene plasmids for HK2

Sources for HK2 Gene

Content
Loading form....