Aliases for HK2 Gene
Aliases for HK2 Gene
External Ids for HK2 Gene
- HGNC: 4923
- Entrez Gene: 3099
- Ensembl: ENSG00000159399
- OMIM: 601125
- UniProtKB: P52789
Previous GeneCards Identifiers for HK2 Gene
- GC02P075198
- GC02P075018
- GC02P075035
- GC02P075034
- GC02P074971
- GC02P075059
Summaries for HK2 Gene
-
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]
GeneCards Summary for HK2 Gene
HK2 (Hexokinase 2) is a Protein Coding gene. Diseases associated with HK2 include Pediatric Osteosarcoma and Chondroblastoma. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Type II diabetes mellitus. GO annotations related to this gene include phosphotransferase activity, alcohol group as acceptor and fructokinase activity. An important paralog of this gene is HK1.
-
Hexokinases catalyze the first essential step of glucose metabolism, the conversion of the substrate glucose into glucose-6-phosphate. This phosphorylation event directly couples extramitochondrial glycolysis to intramitochondrial oxidative phosphorylation.
No data available for CIViC summary , UniProtKB/Swiss-Prot , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HK2 Gene
Genomics for HK2 Gene
Regulatory Elements for HK2 Gene
Regulatory Element Products
Genomic Location for HK2 Gene
- Chromosome:
- 2
- Start:
- 74,832,655 bp from pter
- End:
- 74,893,359 bp from pter
- Size:
- 60,705 bases
- Orientation:
- Plus strand
Genomic View for HK2 Gene
- Cytogenetic band:
-
- 2p12 by Ensembl
- 2p12 by Entrez Gene
- 2p12 by HGNC
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for HK2 Gene
Proteins for HK2 Gene
-
Protein details for HK2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P52789-HXK2_HUMAN
- Recommended name:
- Hexokinase-2
- Protein Accession:
- P52789
- D6W5J2
- Q8WU87
- Q9UN82
Protein attributes for HK2 Gene
- Size:
- 917 amino acids
- Molecular mass:
- 102380 Da
- Quaternary structure:
-
- Monomer (By similarity). Interacts with TIGAR; the interaction increases hexokinase HK2 activity in a hypoxia- and HIF1A-dependent manner (PubMed:23185017).
- Miscellaneous:
-
- In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase).
Protein Expression for HK2 Gene
Selected DME Specific Peptides for HK2 Gene
- P52789:
-
- DIRTEFD
- MRLSDETL
- PDGTEKG
- EWGAFGD
- TMMTCGY
- GFTFSFP
- QVQKVDQ
- RIKENKGEERLRSTIGVDGSVYKKHPHFAKRL
- CQIVSTRSASLCAATLAAVL
- RAAQLCGAG
- DPTQEDCVATHR
- IKDKKLP
- LYHMRLSD
- LIRKAIQRRGDFDIDIVA
- GVDGSVYK
- TGRFETKD
- CGAGMAA
- GFTFSFPC
- NACYMEE
- ATTHPTA
- DGSGKGAA
- LDLGGTNFRV
- AMVTAVA
- SILLKWTKGFKASGCEGEDVVTLLKEAI
- VNDTVGTMM
- VGVDGTLYKLHP
- TRGIFETKFLSQIESD
- YLGEIVRNILIDFTK
- GLIVGTG
- SLNPGKQ
- EGRMCVN
- QTKLDESFLVSWTKGFKS
- GELVRLIL
- HLGLESTC
- VEMHNKIY
- LPLGFTFS
- NMEWGAFGDNGC
- MCINMEWGAFGD
- GSGTQLFDH
- RICQIVS
- ALDLGGTN
- ELFDHIVQCIADFL
- AVDELSLN
- VKMLPTFVR
- GKLSPELL
- SGMYLGEI
- GLSKETHA
Post-translational modifications for HK2 Gene
Other Protein References for HK2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for HK2
- R&D Systems Antibodies for HK2 (Hexokinase 2)
- Cell Signaling Technology (CST) Antibodies for HK2 (HK2)
-
Custom Antibody ServicesOriGene Antibodies for HK2
- Novus Biologicals Antibodies for HK2
-
Cloud-Clone Corp. Antibodies for HK2
- Invitrogen Antibodies for HK2
- antibodies-online Antibodies for HK2: See all 153
- GeneTex HK2 antibody for HK2
-
Santa Cruz Biotechnology (SCBT) Antibodies for HK2
Protein Products
- R&D Systems Proteins and Enzymes for HK2 (Hexokinase 2)
-
OriGene Purified Proteins for HK2
- Search Origene for MassSpec and Protein Over-expression Lysates for HK2
- Origene Custom Protein Services for HK2
- ProSpec Recombinant Proteins for HK2
-
Cloud-Clone Corp. Proteins for HK2
- antibodies-online Proteins for HK2: See all 27
- Search antibodies-online for peptides
- Search GeneTex for Proteins for HK2
Domains & Families for HK2 Gene
Protein Domains for HK2 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for HK2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P52789UniProtKB/Swiss-Prot:
HXK2_HUMAN :- The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus. Each domain can bind a single glucose and Gluc-6-P molecule.
- Belongs to the hexokinase family.
- Domain:
-
- The N- and C-terminal halves of this hexokinase show extensive sequence similarity to each other. The catalytic activity is associated with the C-terminus while regulatory function is associated with the N-terminus. Each domain can bind a single glucose and Gluc-6-P molecule.
- Family:
-
- Belongs to the hexokinase family.
No data available for Gene Families for HK2 Gene
Function for HK2 Gene
Molecular function for HK2 Gene
- GENATLAS Biochemistry:
- hexokinase 2,108kDa,muscle and fat tissues,glycolysis,gluconeogenesis,energy pathways
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + D-hexose = ADP + D-hexose 6-phosphate.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Hexokinase is an allosteric enzyme inhibited by its product Glc-6-P.
Enzyme Numbers (IUBMB) for HK2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003824 | catalytic activity | IEA | -- |
| GO:0004340 | glucokinase activity | TAS | -- |
| GO:0004396 | hexokinase activity | TAS,IEA | 9278438 |
| GO:0005515 | protein binding | IPI | 16189514 |
| GO:0005524 | ATP binding | IEA | -- |
Phenotypes for HK2 Gene
- MGI mutant phenotypes for HK2:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for HK2:
-
- Increased vaccinia virus (VACV) infection
- Decreased shRNA abundance (Z-score < -2)
- Dynamic nuclei (hole, folded or small irregular)
- Increased transferrin (TF) endocytosis
- Transferrin accumulation in the perinuclear area
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased vesicular stomatitis virus (VSV) infection
- Increased HPV18 LCR reporter activity
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Decreased shRNA abundance
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased viability with SS1P at EC90
- Decreased Hepatitis C virus replication
Animal Models for HK2 Gene
- MGI Knock Outs for HK2:
-
- Hk2 tm1Laak
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for HK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HK2 gene
- Search ViGene Biosciences for HK2
CRISPR Products
-
OriGene CRISPR knockouts for HK2
-
Santa Cruz Biotechnology (SCBT) CRISPR for HK2
- GenScript: Design CRISPR guide RNA sequences for HK2
miRNA for HK2 Gene
- miRTarBase miRNAs that target HK2
miRNA Products
- Search ViGene Biosciences for HK2
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HK2
- Browse OriGene Inhibitory RNA Products For HK2
-
ViGene Biosciences ready-to-package AAV shRNAs for HK2 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HK2
Cell Line Products
-
Horizon Cell Lines for HK2
-
ViGene Biosciences adenoviral particle packaged cDNA for HK2 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for HK2 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HK2 gene
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-10169) for HK2
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HK2 Gene
Localization for HK2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HK2 Gene
- Mitochondrion outer membrane. Note=Its hydrophobic N-terminal sequence may be involved in membrane binding. {ECO:0000250}.
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005623 | cell | IEA | -- |
| GO:0005739 | mitochondrion | IEA | -- |
| GO:0005741 | mitochondrial outer membrane | IDA,NAS | 18350175 |
| GO:0005829 | cytosol | TAS | -- |
| GO:0016020 | membrane | IDA,IEA | 19946888 |
Pathways & Interactions for HK2 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Galactose metabolism | ||
| 2 | Glucose metabolism |
.52
|
|
| 3 | Metabolism |
.37
|
|
| 4 | Hexose transport |
.85
|
|
| 5 | Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds | ||
Pathways by source for HK2 Gene
1 Cell Signaling Technology pathway for HK2 Gene
2 BioSystems pathways for HK2 Gene
8 Reactome pathways for HK2 Gene
13 KEGG pathways for HK2 Gene
4 GeneGo (Thomson Reuters) pathways for HK2 Gene
UniProtKB/Swiss-Prot P52789-HXK2_HUMAN
- Pathway: Carbohydrate metabolism; hexose metabolism.
Interacting Proteins for HK2 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001678 | cellular glucose homeostasis | IEA,IBA | -- |
| GO:0002931 | response to ischemia | IEA | -- |
| GO:0005975 | carbohydrate metabolic process | IEA | -- |
| GO:0006006 | glucose metabolic process | IEA | -- |
| GO:0006096 | glycolytic process | IEA,TAS | 23962723 |
No data available for SIGNOR curated interactions for HK2 Gene
Drugs & Compounds for HK2 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| Alpha-D-Glucose |
|
492-62-6 |
|
|||
| Beta-D-Fructose 6-phosphate |
|
|
||||
| dADP |
|
2793-06-8 |
|
|||
| D-Fructose |
|
53188-23-1 |
|
(1) Tocris Compounds for HK2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| GKA 50 | Glucokinase activator | 851884-87-2 |
(1) ApexBio Compounds for HK2 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Lonidamine | 50264-69-2 |
Drug Products
- ApexBio compounds for HK2
Transcripts for HK2 Gene
mRNA/cDNA for HK2 Gene
- (4) REFSEQ mRNAs :
- (6) Additional mRNA sequences :
- (216) Selected AceView cDNA sequences:
- (3) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for HK2 Gene
CRISPR Products
-
OriGene CRISPR knockouts for HK2
-
Santa Cruz Biotechnology (SCBT) CRISPR for HK2
- GenScript: Design CRISPR guide RNA sequences for HK2
miRNA Products
- Search ViGene Biosciences for HK2
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HK2
- Browse OriGene Inhibitory RNA Products For HK2
-
ViGene Biosciences ready-to-package AAV shRNAs for HK2 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HK2
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-10169) for HK2
Expression for HK2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Neural Tube (Nervous System)
- Brain (Nervous System)
- Adipose (Muscoskeletal System)
- Gut Tube (Gastrointestinal Tract)
mRNA differential expression in normal tissues according to GTEx for HK2 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HK2 Gene
NURSA nuclear receptor signaling pathways regulating expression of HK2 Gene:
HK2SOURCE GeneReport for Unigene cluster for HK2 Gene:
Hs.406266mRNA Expression by UniProt/SwissProt for HK2 Gene:
P52789-HXK2_HUMANEvidence on tissue expression from TISSUES for HK2 Gene
- Muscle(4.5)
- Blood(4.3)
- Heart(2.4)
- Intestine(2.3)
- Eye(2.2)
- Liver(2.2)
- Nervous system(2.2)
- Lung(2)
Primer Products
-
OriGene qPCR primer pairs and template standards for HK2
-
OriGene qPCR primer pairs for HK2
No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for HK2 Gene
Orthologs for HK2 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | HK2 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | HK2 35 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | HK2 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | HK2 34 35 |
|
||
| mouse (Mus musculus) |
Mammalia | Hk2 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Hk2 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | HK2 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | HK2 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | HK2 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | LOC100485269 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | hk2 34 35 |
|
||
| Dr.10553 34 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Hex-A 36 35 |
|
||
| Hex-C 36 35 |
|
||||
| Hex-t2 36 35 |
|
||||
| Hex-t1 36 |
|
|
|||
| worm (Caenorhabditis elegans) |
Secernentea | F14B4.2 36 34 35 |
|
||
| H25P06.1 36 |
|
|
|||
| Y77E11A.1 36 |
|
|
|||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | GLK1 35 |
|
ManyToMany | |
| HXK1 35 |
|
ManyToMany | |||
| EMI2 35 |
|
ManyToMany | |||
| HXK2 35 |
|
ManyToMany | |||
| rice (Oryza sativa) |
Liliopsida | Os01g0190400 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.11095 35 |
|
OneToMany |
- Species where no ortholog for HK2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for HK2 Gene
(5) SIMAP similar genes for HK2 Gene using alignment to 4 proteins:
Pseudogenes.org Pseudogenes for HK2 Gene
Variants for HK2 Gene
Polymorphic Variants from UniProtKB/Swiss-Prot for HK2 Gene
- HXK2_HUMAN-P52789
- Although found in NIDDM patients, genetic variations of HK2 do not contribute to the disease (PubMed:7883122, PubMed:7883123).
| SNP ID | Clin | Chr 02 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000000977 | -- | 74,845,386(+) | ATCCC(C/T)CTTTG | intron-variant | |
| rs1000034228 | -- | 74,892,881(+) | TCTGC(A/G)CTAAT | utr-variant-3-prime | |
| rs1000036793 | -- | 74,888,176(+) | TGGCA(A/T)ACACA | intron-variant | |
| rs1000132043 | -- | 74,870,825(+) | AAATG(C/T)TTTGG | intron-variant | |
| rs1000145026 | -- | 74,888,345(+) | GCTCA(G/T)AGCAT | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv3871n100 | CNV | gain | 25217958 |
| esv2659874 | CNV | deletion | 23128226 |
| esv2677814 | CNV | deletion | 23128226 |
| esv2751900 | CNV | gain | 17911159 |
| esv2760619 | CNV | loss | 21179565 |
| esv3591289 | CNV | loss | 21293372 |
| esv3591291 | CNV | loss | 21293372 |
| nsv1001495 | CNV | gain | 25217958 |
| nsv1109262 | CNV | deletion | 24896259 |
| nsv1138786 | CNV | deletion | 24896259 |
| nsv518615 | CNV | gain | 19592680 |
| nsv519007 | CNV | loss | 19592680 |
| nsv582217 | CNV | gain | 21841781 |
| nsv829465 | CNV | loss | 20364138 |
| nsv998325 | CNV | gain | 25217958 |
Relevant External Links for HK2 Gene
Disorders for HK2 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pediatric osteosarcoma |
|
|
| chondroblastoma |
|
|
| diabetes mellitus, noninsulin-dependent |
|
|
| hepatocellular carcinoma |
|
Relevant External Links for HK2
No data available for UniProtKB/Swiss-Prot and Genatlas for HK2 Gene
Publications for HK2 Gene
- Amino acid substitutions in hexokinase II among patients with NIDDM. (PMID: 7883120) Laakso M. … Deeb S.S. (Diabetes 1995) 3 4 22 46 64
- Analysis of the hexokinase II gene in subjects with insulin resistance and NIDDM and detection of a Gln142-->His substitution. (PMID: 7883122) Vidal-Puig A. … Moller D.E. (Diabetes 1995) 3 4 22 46 64
- Identification of four amino acid substitutions in hexokinase II and studies of relationships to NIDDM, glucose effectiveness, and insulin sensitivity. (PMID: 7883123) Echwald S.M. … Pedersen O. (Diabetes 1995) 3 4 22 46 64
- Human hexokinase II gene: exon-intron organization, mutation screening in NIDDM, and its relationship to muscle hexokinase activity. (PMID: 8786021) Lehto M. … Groop L.C. (Diabetologia 1995) 3 4 22 64
- Steady state transcript levels of the type II hexokinase and type 1 glucose transporter in human tumor cell lines. (PMID: 7518342) Shinohara Y. … Terada H. (Cancer Lett. 1994) 3 4 22 64
Products for HK2 Gene
- R&D Systems Antibodies for HK2 (Hexokinase 2)
- R&D Systems Proteins and Enzymes for HK2 (Hexokinase 2)
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for HK2
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HK2
- Search Origene for MassSpec and Protein Over-expression Lysates for HK2
- Origene Custom Protein Services for HK2
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HK2
- Browse OriGene Inhibitory RNA Products For HK2
- OriGene qPCR primer pairs and template standards for HK2
- OriGene qPCR primer pairs for HK2
- OriGene CRISPR knockouts for HK2
- OriGene ORF clones in human for HK2
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HK2
- GenScript: Next-day shipping cDNA ORF clone for HK2 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for HK2
- GenScript Custom Assay Services for HK2
- GenScript Custom overexpressing Cell Line Services for HK2
- GenScript: Design CRISPR guide RNA sequences for HK2
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for HK2
- Cell Signaling Technology (CST) Antibodies for HK2 (HK2)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for HK2
- Novus Biologicals proteins and lysates for HK2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- ProSpec Recombinant Proteins for HK2
- Cloud-Clone Corp. Antibodies for HK2
- Cloud-Clone Corp. Proteins for HK2
- Cloud-Clone Corp Assay Kits for HK2
- Invitrogen Antibodies for HK2
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for HK2
- Addgene plasmids for HK2
- antibodies-online Antibodies for HK2: See all 153
- antibodies-online Kits for HK2: See all 24
- antibodies-online Proteins for HK2: See all 27
- Search antibodies-online for peptides
- GeneTex HK2 antibody for HK2
- Search GeneTex for Proteins for HK2
- ViGene Biosciences adenoviral particle packaged cDNA for HK2 gene
- ViGene Biosciences lentiviral particle packaged cDNA for HK2 gene
- ViGene Biosciences ready-to-package AAV shRNAs for HK2 gene
- Search ViGene Biosciences for HK2
- Santa Cruz Biotechnology (SCBT) Antibodies for HK2
- Search Santa Cruz Biotechnology (SCBT) for HK2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for HK2
- Horizon Cell Lines for HK2
- Cyagen custom Knockout/knockin (KOKI) mouse models for HK2
- VectorBuilder custom plasmid, inducible vectors for HK2
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for HK2
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for HK2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer




