Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HIPK4 Gene

Aliases for HIPK4 Gene

  • Homeodomain Interacting Protein Kinase 4 2 3 5
  • EC 2.7.11.1 4 61

External Ids for HIPK4 Gene

Previous GeneCards Identifiers for HIPK4 Gene

  • GC19M045577
  • GC19M040885
  • GC19M037320

Summaries for HIPK4 Gene

Entrez Gene Summary for HIPK4 Gene

  • This gene encodes a member of the homeodomain interacting protein kinase (HIPK) family of proteins. While other members of this family are found throughout vertebrates, this member is present only in mammals. Compared to other members of this family, the encoded protein lacks a nuclear localization signal and a C-terminal autoinhibitory domain. The encoded protein exhibits kinase activity and may phosphorylate the tumor suppressor protein p53. [provided by RefSeq, Jul 2016]

GeneCards Summary for HIPK4 Gene

HIPK4 (Homeodomain Interacting Protein Kinase 4) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK3.

UniProtKB/Swiss-Prot for HIPK4 Gene

  • Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter (By similarity). May act as a corepressor of transcription factors (Potential).

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK4 Gene

Genomics for HIPK4 Gene

Regulatory Elements for HIPK4 Gene

Enhancers for HIPK4 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH19G040441 1.4 ENCODE dbSUPER 11.4 -54.0 -54028 5.4 MLX CREB3L1 AGO1 ZFP64 FEZF1 DMAP1 YY1 ZNF143 SP3 NFYC EID2B SERTAD3 ENSG00000205041 ENSG00000269069 SNRPA ENSG00000269843 ZNF546 HIPK4 FBL ITPKC
GH19G040190 1.4 FANTOM5 ENCODE 10.4 +199.0 198994 2.3 HDGF PKNOX1 CREB3L1 AGO1 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B ZNF766 ENSG00000205041 NUMBL EID2B ENSG00000269069 TTC9B CNTD2 HIPK4 ENSG00000206925 C19orf47 PLD3
GH19G040622 1.5 Ensembl ENCODE dbSUPER 9.6 -233.3 -233309 2.0 HDGF PKNOX1 ATF1 FOXA2 ZNF2 GLIS2 CBX5 KLF7 ZNF263 SP3 SHKBP1 NUMBL ENSG00000205041 SNRPA ENSG00000269843 ENSG00000269069 ITPKC FBL SERTAD3 SERTAD1
GH19G040157 1.1 ENCODE 10.4 +233.0 232993 0.2 CREB3L1 MLX AGO1 ARID4B SIN3A DMAP1 FEZF1 ZNF2 SLC30A9 ZNF143 SNRPA FBL ITPKC ENSG00000269843 PSMC4 TTC9B CNTD2 RPS16 HIPK4 RN7SL566P
GH19G040639 1 Ensembl ENCODE 9.6 -250.8 -250816 3.0 KLF1 HINFP ETV1 ZMYM3 ZNF121 ZFHX2 GLIS2 ZNF366 NCOR1 EGR1 NUMBL SHKBP1 RNU6-195P SNRPA C19orf54 SERTAD3 SERTAD1 ENSG00000206925 C19orf47 PLD3
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around HIPK4 on UCSC Golden Path with GeneCards custom track

Genomic Location for HIPK4 Gene

Chromosome:
19
Start:
40,379,271 bp from pter
End:
40,390,221 bp from pter
Size:
10,951 bases
Orientation:
Minus strand

Genomic View for HIPK4 Gene

Genes around HIPK4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK4 Gene

Proteins for HIPK4 Gene

  • Protein details for HIPK4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8NE63-HIPK4_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 4
    Protein Accession:
    Q8NE63
    Secondary Accessions:
    • A8K863
    • Q96M54

    Protein attributes for HIPK4 Gene

    Size:
    616 amino acids
    Molecular mass:
    69425 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAB71458.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};

neXtProt entry for HIPK4 Gene

Selected DME Specific Peptides for HIPK4 Gene

Q8NE63:
  • RVKVIDFGSAS
  • ALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSA

Post-translational modifications for HIPK4 Gene

Other Protein References for HIPK4 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for HIPK4 Gene

Gene Families for HIPK4 Gene

Protein Domains for HIPK4 Gene

Graphical View of Domain Structure for InterPro Entry

Q8NE63

UniProtKB/Swiss-Prot:

HIPK4_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK4: view

Function for HIPK4 Gene

Molecular function for HIPK4 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter (By similarity). May act as a corepressor of transcription factors (Potential).

Enzyme Numbers (IUBMB) for HIPK4 Gene

Gene Ontology (GO) - Molecular Function for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003677 DNA binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 25416956
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with HIPK4: view
genes like me logo Genes that share phenotypes with HIPK4: view

Animal Model Products

CRISPR Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for HIPK4 Gene

Localization for HIPK4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK4 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK4 gene
Compartment Confidence
nucleus 3
cytosol 1

Gene Ontology (GO) - Cellular Components for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with HIPK4: view

Pathways & Interactions for HIPK4 Gene

SuperPathways for HIPK4 Gene

No Data Available

Gene Ontology (GO) - Biological Process for HIPK4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0016310 phosphorylation IEA --
GO:0016572 histone phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IEA --
GO:0046777 protein autophosphorylation IEA --
genes like me logo Genes that share ontologies with HIPK4: view

No data available for Pathways by source and SIGNOR curated interactions for HIPK4 Gene

Transcripts for HIPK4 Gene

mRNA/cDNA for HIPK4 Gene

(2) REFSEQ mRNAs :
(5) Additional mRNA sequences :
(18) Selected AceView cDNA sequences:
(1) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for HIPK4 Gene

Homeodomain interacting protein kinase 4:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK4 Gene

No ASD Table

Relevant External Links for HIPK4 Gene

GeneLoc Exon Structure for
HIPK4
ECgene alternative splicing isoforms for
HIPK4

Expression for HIPK4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK4 Gene

mRNA differential expression in normal tissues according to GTEx for HIPK4 Gene

This gene is overexpressed in Testis (x15.9), Brain - Nucleus accumbens (basal ganglia) (x5.4), and Brain - Cortex (x4.0).

NURSA nuclear receptor signaling pathways regulating expression of HIPK4 Gene:

HIPK4

SOURCE GeneReport for Unigene cluster for HIPK4 Gene:

Hs.79363
genes like me logo Genes that share expression patterns with HIPK4: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt , Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK4 Gene

Orthologs for HIPK4 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK4 34 35
  • 98.32 (n)
dog
(Canis familiaris)
Mammalia HIPK4 34
  • 88.65 (n)
-- 35
  • 83 (a)
ManyToMany
cow
(Bos Taurus)
Mammalia HIPK4 34 35
  • 87.86 (n)
mouse
(Mus musculus)
Mammalia Hipk4 34 16 35
  • 83.58 (n)
rat
(Rattus norvegicus)
Mammalia Hipk4 34
  • 83.25 (n)
oppossum
(Monodelphis domestica)
Mammalia HIPK4 35
  • 79 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK4 35
  • 63 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia HIPK4 35
  • 58 (a)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea C36B7.2 35
  • 20 (a)
ManyToMany
C36B7.1 35
  • 19 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 35
  • 15 (a)
OneToMany
Species where no ortholog for HIPK4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • zebrafish (Danio rerio)

Evolution for HIPK4 Gene

ENSEMBL:
Gene Tree for HIPK4 (if available)
TreeFam:
Gene Tree for HIPK4 (if available)

Paralogs for HIPK4 Gene

(5) SIMAP similar genes for HIPK4 Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with HIPK4: view

Variants for HIPK4 Gene

Sequence variations from dbSNP and Humsavar for HIPK4 Gene

SNP ID Clin Chr 19 pos Sequence Context AA Info Type
rs193920880 Uncertain significance 40,380,712(-) CCATC(A/G)ACCAG reference, missense
rs1000055875 -- 40,384,458(+) ACCAC(C/T)ACACC intron-variant
rs1000109127 -- 40,380,895(+) GCGCA(A/G)CGAGA reference, synonymous-codon
rs1000172461 -- 40,387,591(+) CTCCT(A/G)CATCA intron-variant
rs1000386301 -- 40,390,086(+) ACACT(A/G)TCAGT utr-variant-5-prime

Structural Variations from Database of Genomic Variants (DGV) for HIPK4 Gene

Variant ID Type Subtype PubMed ID
esv3644347 CNV loss 21293372
nsv833831 CNV loss 17160897

Variation tolerance for HIPK4 Gene

Residual Variation Intolerance Score: 62.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.82; 67.03% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for HIPK4 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK4

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK4 Gene

Disorders for HIPK4 Gene

Relevant External Links for HIPK4

Genetic Association Database (GAD)
HIPK4
Human Genome Epidemiology (HuGE) Navigator
HIPK4
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
HIPK4

No disorders were found for HIPK4 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK4 Gene

Publications for HIPK4 Gene

  1. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  2. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  3. Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK). (PMID: 25630557) van der Laden J. … Becker W. (Cell Commun. Signal 2015) 3 64
  4. A proteome-scale map of the human interactome network. (PMID: 25416956) Rolland T. … Vidal M. (Cell 2014) 3 64
  5. Integration of stress signals by homeodomain interacting protein kinases. (PMID: 24225127) Schmitz M.L. … Hornung J. (Biol. Chem. 2014) 3 64

Products for HIPK4 Gene

Sources for HIPK4 Gene

Content
Loading form....