Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

HIPK4 Gene

protein-coding   GIFtS: 45
GCID: GC19M040885

homeodomain interacting protein kinase 4

 Explore 1 disease affiliated with
HIPK4 via our new
 Human Malady Compendium 
Biological research products
for HIPK4
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Homeodomain Interacting Protein Kinase 41 2
EC 2.7.11.13 8
FLJ328181
Homeodomain-Interacting Protein Kinase 42

External Ids:    HGNC: 190071   Entrez Gene: 1477462   Ensembl: ENSG000001603967   OMIM: 6117125   UniProtKB: Q8NE633   

Export aliases for HIPK4 gene to outside databases

Previous GC identifers: GC19M045577 GC19M037320


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63
Function: Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter
(By similarity). May act as a corepressor of transcription factors (Potential)




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000019.9  NC_018930.1  NT_011109.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the HIPK4 gene promoter:
         SRF   Pax-5   SRF (504 AA)   AP-4   XBP-1   E47   PPAR-gamma1   Hand1   PPAR-gamma2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidHIPK4 promoter sequence
   Search SABiosciences Chromatin IP Primers for HIPK4

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HIPK4


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 19q13.2   Ensembl cytogenetic band:  19q13.2   HGNC cytogenetic band: 19q13.2

HIPK4 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
HIPK4 gene location

GeneLoc information about chromosome 19         GeneLoc Exon Structure

GeneLoc location for GC19M040885:  view genomic region     (about GC identifiers)

Start:
40,885,178 bp from pter      End:
40,896,094 bp from pter
Size:
10,917 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63 (See protein sequence)
Recommended Name: Homeodomain-interacting protein kinase 4  
Size: 616 amino acids; 69425 Da
Subcellular location: Cytoplasm (By similarity)
Sequence caution: Sequence=BAB71458.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing;
Secondary accessions: A8K863 Q96M54

Explore the universe of human proteins at neXtProt for HIPK4: NX_Q8NE63

Post-translational modifications:

  • Autophosphorylated (By similarity)1
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q8NE63

  • 2 DME Specific Peptides for HIPK4 (Q8NE63)
     RVKVIDFGSAS  ALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSA 

    HIPK4 Protein expression data from MOPED and PaxDb:    About this image 
    HIPK4 Protein Expression
    REFSEQ proteins: NP_653286.2  
    ENSEMBL proteins: 
     ENSP00000291823  

    Human Recombinant Protein Products for HIPK4: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for HIPK4 
    GenScript Custom Purified and Recombinant Proteins Services for HIPK4
    Novus Biologicals HIPK4 Proteins
    Novus Biologicals HIPK4 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for HIPK4

    Gene Ontology (GO): 1 cellular component term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005737cytoplasm IEA--

    HIPK4 for ontologies           About GeneDecksing



    HIPK4 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for HIPK4 
    GenScript Custom Superior Antibodies Services for HIPK4
    Novus Biologicals HIPK4 Antibodies
    Abcam antibodies for HIPK4 
    Uscn Antibodies for HIPK4
    ThermoFisher Antibodies for HIPK4

    Assay Products for HIPK4: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for HIPK4
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for HIPK4


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    HIPK4 for domains           About GeneDecksing

    5 InterPro domains/families:
     IPR017441 Protein_kinase_ATP_BS
     IPR002290 Ser/Thr_dual-sp_kinase_dom
     IPR011009 Kinase-like_dom
     IPR008271 Ser/Thr_kinase_AS
     IPR000719 Prot_kinase_cat_dom

    Graphical View of Domain Structure for InterPro Entry Q8NE63

    ProtoNet protein and cluster: Q8NE63

    UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63
    Similarity: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily
    Similarity: Contains 1 protein kinase domain


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, Sirion Biotech, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, Sirion Biotech, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: HIPK4_HUMAN, Q8NE63
    Function: Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter
    (By similarity). May act as a corepressor of transcription factors (Potential)
    Catalytic activity: ATP + a protein = ADP + a phosphoprotein

         Enzyme Number (IUBMB): EC 2.7.11.11 2

         Gene Ontology (GO): 3 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003677DNA binding ----
    GO:0004674protein serine/threonine kinase activity IEA--
    GO:0005524ATP binding IEA--
         
    HIPK4 for ontologies           About GeneDecksing


    Phenotypes:
         2 GenomeRNAi human phenotypes for HIPK4:
     Decreased focal adhesion (FA)   Increased viability after born 

    Animal Models:
       inGenious Targeting Laboratory - Customizable classic, inducible, and humanized mouse model solutions for HIPK4 

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: HIPK4
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HIPK4
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate HIPK4
    SwitchGear 3'UTR luciferase reporter plasmidHIPK4 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HIPK4 (see all 7)
    OriGene shRNA RFP: HIPK4
    OriGene siRNA: HIPK4
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4
    Sirion Biotech Custom design and validation of potent shRNA sequences against HIPK4 

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for HIPK4
    Sirion Biotech Customized adenovirus for overexpression of HIPK4 
    Sirion Biotech Customized adenovirus for potent knockdown of HIPK4

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4 (see all 2)
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: HIPK4 (NM_144685)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HIPK4
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for HIPK4
    Search LifeMap BioReagents cell lines for HIPK4
    Sirion Biotech Customized stable knockdown cell line services for HIPK4 
    Sirion Biotech Customized inducible knockdown cell line services for HIPK4
    Sirion Biotech Customized stable overexpressing cell line services for HIPK4
    Sirion Biotech Customized inducible overexpressing cell line services for HIPK4

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section



    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for HIPK4

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for HIPK4
    Search CenterWatch for drugs/clinical trials and news about HIPK4 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, Sirion Biotech, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for HIPK4 gene: 
    NM_144685.3  

    Unigene Cluster for HIPK4:

    Homeodomain interacting protein kinase 4
    Hs.79363  [show with all ESTs]
    Unigene Representative Sequence: NM_144685
    1 Ensembl transcript including schematic representation, and UCSC links where relevant:
    ENST00000291823(uc002onp.3)

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: HIPK4
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HIPK4
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate HIPK4
    SwitchGear 3'UTR luciferase reporter plasmidHIPK4 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HIPK4 (see all 7)
    OriGene shRNA RFP: HIPK4
    OriGene siRNA: HIPK4
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4
    Sirion Biotech Custom design and validation of potent shRNA sequences against HIPK4 
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4 (see all 2)
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: HIPK4 (NM_144685)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HIPK4
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HIPK4
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse / rat HIPK4
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4

    Additional cDNA sequence: 

    AK057380.1 AK292228.1 AK301713.1 AK302301.1 BC034501.2 

    3 DOTS entries:

    DT.100016640  DT.100667090  DT.435710 

    18 AceView cDNA sequences:

    NM_144685 AK057380 BC034501 BI827147 AI001807 BX099852 AI806773 BM554291 
    CD637134 BG772881 CD637132 BU678003 CD637135 CD637133 BI561789 BG771831 
    BG720082 BF950933 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    HIPK4 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TCACCGGGCA
    HIPK4 Expression
    About this image
    See HIPK4 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for HIPK4

    SOURCE GeneReport for Unigene cluster: Hs.79363
        SABiosciences Custom PCR Arrays for HIPK4

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HIPK4
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse / rat HIPK4
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of chordates.

    Orthologs for HIPK4 gene from 2/10 species (see all 10)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    lizard
    (Anolis carolinensis)
    Reptilia HIPK46
    --
    57(a)
    1 ↔ 1
    LGf(2208199-2211558)
    rainbow trout
    (Oncorhynchus mykiss)
    Actinopterygii BX073989.12   -- 74.16(n)    BX073989.1 


    ENSEMBL Gene Tree for HIPK4 (if available)
    TreeFam Gene Tree for HIPK4 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for HIPK4 gene
    DYRK32  DYRK22  DYRK1A2  HIPK12  DYRK42  HIPK32  HIPK22  DYRK1B2  
    5 SIMAP similar genes for HIPK4 using alignment to 1 protein entry:     HIPK4_HUMAN:
    HIPK1    HIPK2    CDK2    CDK3    CDK4

    HIPK4 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/266 NCBI SNPs in HIPK4 are shown (see all 266    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 19 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs576136211,2
    C,F--40884891(+) CAACAG/TACAAG 1 -- int11Minor allele frequency- T:0.09WA 118
    rs1855350681,2
    --40884911(+) GCATCC/TGGCAA 1 -- int10--------
    rs1476714521,2
    --40885054(+) CTCCCA/GCCTAA 1 -- int10--------
    rs22782271,2
    C,F,A,H--40885071(-) CCCAGC/TTGACC 1 -- int127Minor allele frequency- T:0.48NS EA NA WA CSA 2716
    rs1902986861,2
    --40885102(+) CACTGA/GGTGCC 1 -- int10--------
    rs1491043411,2
    --40885130(+) CCCCCC/GAGGGC 1 -- int10--------
    rs1431737741,2
    --40885350(+) CAGACA/GGGGAA 1 -- ut310--------
    rs124607411,2
    C,F,H--40885409(+) AGGAGA/TTGGCT 1 -- ut31 ese35Minor allele frequency- T:0.01NS EA NA 420
    rs2006072931,2
    --40885506(+) TGCCCA/GGTGAC 2 T syn10--------
    rs2009996811,2
    --40885533(+) GTGGCC/TCCCCG 2 G syn10--------

    HapMap Linkage Disequilibrium report for HIPK4 (40885178 - 40896094 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for HIPK4: --

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing HIPK4
    DNA2.0 Custom Variant and Variant Library Synthesis for HIPK4

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    HIPK4 for disorders           About GeneDecksing

    OMIM gene information: 611712    OMIM disorders: --

    1 disease for HIPK4:    About MalaCards
    malaria

    Human Genome Epidemiology (HuGE) Navigator: HIPK4 (2 documents)

    Export disorders for HIPK4 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for HIPK4 gene integrated from 9 sources:
    (articles sorted by number of sources associating them with HIPK4)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    3. Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9. (PubMed id 18022393)1 Arai S.... Kurokawa R. (2007)
    4. Patterns of somatic mutation in human cancer genomes. (PubMed id 17344846)2 Greenman C.... Stratton M.R. (2007)
    5. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)1 Strausberg R.L....Marra M.A. (2002)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 147746 HGNC: 19007 AceView: HIPK4 Ensembl:ENSG00000160396 euGenes: HUgn147746
    ECgene: HIPK4 H-InvDB: HIPK4

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for HIPK4 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for HIPK4 gene:
    Search GeneIP for patents involving HIPK4

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, LifeMap BioReagents, and Sirion Biotech, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory)
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     Browse OriGene Antibodies   OriGene shRNA RFP for HIPK4  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for HIPK4   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for HIPK4  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for HIPK4   OriGene 3'-UTR Clone for HIPK4  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for HIPK4  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for HIPK4   OriGene Custom Protein Services for HIPK4  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat HIPK4
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing HIPK4
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HIPK4
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
     GenScript Custom Purified and Recombinant Proteins Services for HIPK4 GenScript cDNA clones with any tag delivered in your preferred vector for HIPK4
     GenScript Custom Assay Services for HIPK4 GenScript Custom Superior Antibodies Services for HIPK4
     GenScript Custom overexpressing Cell Line Services for HIPK4 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in HIPK4 promoter
     Search Chromatin IP Primers for HIPK4
     RT2 qPCR Primer Assay in human, mouse / rat HIPK4
     Search GNC Networks for HIPK4
     SABiosciences Custom PCR Arrays for HIPK4
     Search Tocris compounds for HIPK4
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     HIPK4 antibodies
     HIPK4 proteins
     HIPK4 lysates
     Antibodies for HIPK4
     See all of Abcam's Antibodies, Kits and Proteins for HIPK4
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     HIPK4 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for HIPK4
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4
     SwitchGear 3'UTR luciferase reporter plasmids for HIPK4
     SwitchGear Promoter luciferase reporter plasmids for HIPK4
     ThermoFisher Antibodies for HIPK4
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4
     inGenious Targeting Laboratory - Customizable classic, inducible, and humanized mouse model solutions for HIPK4
    Sirion Biotech Customized:
     stable knockdown cell line services for HIPK4
     inducible knockdown cell line services for HIPK4
     design and validation of potent shRNA sequences against HIPK4
     adenovirus for potent knockdown of HIPK4
     adenovirus for overexpression of HIPK4
     stable overexpressing cell line services for HIPK4
     inducible overexpressing cell line services for HIPK4
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013 , 14 May 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      HIPK4 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 106 solr: 1.4