Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

HIPK4 Gene

protein-coding   GIFtS: 48
GCID: GC19M040885

Homeodomain Interacting Protein Kinase 4

  Search for HIPK4
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

Aliases
Homeodomain Interacting Protein Kinase 41 2
EC 2.7.11.13 8
Homeodomain-Interacting Protein Kinase 42

External Ids:    HGNC: 190071   Entrez Gene: 1477462   Ensembl: ENSG000001603967   OMIM: 6117125   UniProtKB: Q8NE633   

Export aliases for HIPK4 gene to outside databases

Previous GC identifers: GC19M045577 GC19M037320


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

GeneCards Summary for HIPK4 Gene: 
HIPK4 (homeodomain interacting protein kinase 4) is a protein-coding gene. GO annotations related to this gene include protein serine/threonine kinase activity and ATP binding. An important paralog of this gene is DYRK1A.

UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63
Function: Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5
promoter (By similarity). May act as a corepressor of transcription factors (Potential)




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000019.9  NC_018930.2  NT_011109.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the HIPK4 gene promoter:
         SRF   Pax-5   SRF (504 AA)   AP-4   XBP-1   E47   PPAR-gamma1   Hand1   PPAR-gamma2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidHIPK4 promoter sequence
   Search SABiosciences Chromatin IP Primers for HIPK4

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HIPK4


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 19q13.2   Ensembl cytogenetic band:  19q13.2   HGNC cytogenetic band: 19q13.2

HIPK4 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
HIPK4 gene location

GeneLoc information about chromosome 19         GeneLoc Exon Structure

GeneLoc location for GC19M040885:  view genomic region     (about GC identifiers)

Start:
40,885,178 bp from pter      End:
40,896,094 bp from pter
Size:
10,917 bases      Orientation:
minus strand

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63 (See protein sequence)
Recommended Name: Homeodomain-interacting protein kinase 4  
Size: 616 amino acids; 69425 Da
Subcellular location: Cytoplasm (By similarity)
Sequence caution: Sequence=BAB71458.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing;
Secondary accessions: A8K863 Q96M54

Explore the universe of human proteins at neXtProt for HIPK4: NX_Q8NE63

Explore proteomics data for HIPK4 at MOPED 

Post-translational modifications:

  • UniProtKB: Autophosphorylated (By similarity)
  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_Q8NE63

  • 2 DME Specific Peptides for HIPK4 (Q8NE63)
     RVKVIDFGSAS  ALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSA 

    HIPK4 Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    HIPK4 Protein Expression
    REFSEQ proteins: NP_653286.2  
    ENSEMBL proteins: 
     ENSP00000291823  

    Human Recombinant Protein Products for HIPK4: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom MassSpec 
    OriGene Custom Protein Services for HIPK4
    GenScript Custom Purified and Recombinant Proteins Services for HIPK4
    Novus Biologicals HIPK4 Proteins
    Novus Biologicals HIPK4 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates 
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for HIPK4 

    Gene Ontology (GO): 1 cellular component term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005737cytoplasm IEA--

    HIPK4 for ontologies           About GeneDecksing



    HIPK4 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for HIPK4
    GenScript Custom Superior Antibodies Services for HIPK4
    Novus Biologicals HIPK4 Antibodies
    Abcam antibodies for HIPK4
    Cloud-Clone Corp. Antibodies for HIPK4 
    ThermoFisher Antibodies for HIPK4
    LSBio Antibodies in human, mouse, rat for HIPK4 

    Assay Products for HIPK4: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for HIPK4
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for HIPK4
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for HIPK4 
    Cloud-Clone Corp. CLIAs for HIPK4


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    IUPHAR Guide to PHARMACOLOGY protein family classification: homeodomain interacting protein kinase 4 
    HIPK subfamily

    5 InterPro protein domains:
     IPR017441 Protein_kinase_ATP_BS
     IPR002290 Ser/Thr_dual-sp_kinase_dom
     IPR011009 Kinase-like_dom
     IPR008271 Ser/Thr_kinase_AS
     IPR000719 Prot_kinase_cat_dom

    Graphical View of Domain Structure for InterPro Entry Q8NE63

    ProtoNet protein and cluster: Q8NE63

    UniProtKB/Swiss-Prot: HIPK4_HUMAN, Q8NE63
    Similarity: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily
    Similarity: Contains 1 protein kinase domain


    HIPK4 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: HIPK4_HUMAN, Q8NE63
    Function: Protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5
    promoter (By similarity). May act as a corepressor of transcription factors (Potential)
    Catalytic activity: ATP + a protein = ADP + a phosphoprotein

         Enzyme Number (IUBMB): EC 2.7.11.11 2

         Gene Ontology (GO): 5 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004672protein kinase activity ----
    GO:0004674protein serine/threonine kinase activity IEA--
    GO:0004713protein tyrosine kinase activity ----
    GO:0005524ATP binding IEA--
    GO:0016772transferase activity, transferring phosphorus-containing groups ----
         
    HIPK4 for ontologies           About GeneDecksing


    Phenotypes:
         2 GenomeRNAi human phenotypes for HIPK4:
     Decreased focal adhesion (FA)   Increased viability after born 

    Animal Models:
       inGenious Targeting Laboratory - Custom generated mouse model solutions for HIPK4 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for HIPK4

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for HIPK4 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for HIPK4 

    miRNA
    Products:
        
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HIPK4
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate HIPK4
    SwitchGear 3'UTR luciferase reporter plasmidHIPK4 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for HIPK4
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for HIPK4
    Sirion Biotech Customized adenovirus for overexpression of HIPK4

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for HIPK4 (see all 6)
    OriGene ORF clones in mouse, rat for HIPK4
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: HIPK4 (NM_144685)
    Sino Biological Human cDNA Clone for HIPK4
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HIPK4
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4
    Sirion Biotech Customized lentivirus for stable overexpression of HIPK4 
                         Customized lentivirus expression plasmids for stable overexpression of HIPK4 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for HIPK4
    Search LifeMap BioReagents cell lines for HIPK4
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section




    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for HIPK4

    Gene Ontology (GO): 1 biological process term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006468protein phosphorylation ----

    HIPK4 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for HIPK4

    Search CenterWatch for drugs/clinical trials and news about HIPK4

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for HIPK4 gene: 
    NM_144685.3  

    Unigene Cluster for HIPK4:

    Homeodomain interacting protein kinase 4
    Hs.79363  [show with all ESTs]
    Unigene Representative Sequence: NM_144685
    1 Ensembl transcript including schematic representation, and UCSC links where relevant:
    ENST00000291823(uc002onp.3)
    miRNA
    Products:
         
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat HIPK4
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate HIPK4
    SwitchGear 3'UTR luciferase reporter plasmidHIPK4 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for HIPK4
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4
    Clone
    Products:
         
    OriGene clones in human, mouse for HIPK4 (see all 6)
    OriGene ORF clones in mouse, rat for HIPK4
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: HIPK4 (NM_144685)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for HIPK4
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4
    Sirion Biotech Customized lentivirus for stable overexpression of HIPK4 
                         Customized lentivirus expression plasmids for stable overexpression of HIPK4 
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for HIPK4
    OriGene qSTAR qPCR primer pairs in human, mouse for HIPK4
    SABiosciences RT2 qPCR Primer Assay in human, mouse / rat HIPK4
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4

    Additional mRNA sequence: 

    AK057380.1 AK292228.1 AK301713.1 AK302301.1 BC034501.2 

    3 DOTS entries:

    DT.100016640  DT.100667090  DT.435710 

    18 AceView cDNA sequences:

    BC034501 NM_144685 AK057380 BM554291 CD637132 CD637133 AI001807 BI827147 
    BU678003 CD637134 CD637135 BX099852 BG772881 AI806773 BG771831 BI561789 
    BG720082 BF950933 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    HIPK4 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TCACCGGGCA
    HIPK4 Expression
    About this image


    See HIPK4 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for HIPK4

    SOURCE GeneReport for Unigene cluster: Hs.79363
        SABiosciences Custom PCR Arrays for HIPK4
    Primer
    Products:
    OriGene qPCR primer pairs and template standards for HIPK4
    OriGene qSTAR qPCR primer pairs in human, mouse for HIPK4
    SABiosciences RT2 qPCR Primer Assay in human, mouse / rat HIPK4
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals and fungi.

    Orthologs for HIPK4 gene from 5/11 species (see all 11)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Hipk41 , 5 homeodomain interacting protein kinase 41, 5 83.58(n)1
    87.32(a)1
      7 (15.92 cM)5
    2330201  NM_001033315.21  NP_001028487.21 
     275232675 
    lizard
    (Anolis carolinensis)
    Reptilia HIPK46
    Uncharacterized protein
    58(a)
    1 ↔ 1
    LGf(2208199-2211558)
    rainbow trout
    (Oncorhynchus mykiss)
    Actinopterygii BX073989.12   -- 74.16(n)    BX073989.1 
    worm
    (Caenorhabditis elegans)
    Secernentea C36B7.26
    C36B7.16
    Protein C36B7.1
    18(a)
    17(a)
    possible ortholog
    possible ortholog
    X(7106407-7108436)
    X(7112889-7114863)
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes YAK16
    Serine-threonine protein kinase; component of a gl...
    15(a)
    1 → many
    X(147967-150390)


    ENSEMBL Gene Tree for HIPK4 (if available)
    TreeFam Gene Tree for HIPK4 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for HIPK4 gene
    DYRK1A2  DYRK22  DYRK32  HIPK12  DYRK42  HIPK32  HIPK22  DYRK1B2  
    5 SIMAP similar genes for HIPK4 using alignment to 1 protein entry:     HIPK4_HUMAN:
    HIPK1    HIPK2    CDK2    CDK3    CDK4

    HIPK4 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/346 SNPs in HIPK4 are shown (see all 346)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 19 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1939208801,2
    Cuntested140886619(-) CCATCA/GACCAG 2 N D mis10--------
    rs576136211,2
    C,F--40884891(+) CAACAG/TACAAG 1 -- int11Minor allele frequency- T:0.09WA 118
    rs1855350681,2
    --40884911(+) GCATCC/TGGCAA 1 -- int10--------
    rs1476714521,2
    --40885054(+) CTCCCA/GCCTAA 1 -- int10--------
    rs22782271,2
    C,F,A,H--40885071(-) CCCAGC/TTGACC 1 -- int127Minor allele frequency- T:0.48NS EA NA WA CSA 2716
    rs1902986861,2
    --40885102(+) CACTGA/GGTGCC 1 -- int10--------
    rs1491043411,2
    --40885130(+) CCCCCC/GAGGGC 1 -- int10--------
    rs1431737741,2
    --40885350(+) CAGACA/GGGGAA 1 -- ut310--------
    rs124607411,2
    C,F,H--40885409(+) AGGAGA/TTGGCT 1 -- ut31 ese35Minor allele frequency- T:0.01NS EA NA 420
    rs2006072931,2
    --40885506(+) TGCCCA/GGTGAC 2 T syn10--------

    HapMap Linkage Disequilibrium report for HIPK4 (40885178 - 40896094 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 2 variations for HIPK4:    About this table     
    Variant IDTypeSubtypePubMed ID
    dgv3867n71CNV Loss21882294
    nsv833831CNV Loss17160897

    SABiosciences Cancer Mutation PCR Assays
    SeqTarget long-range PCR primers for resequencing HIPK4
    DNA2.0 Custom Variant and Variant Library Synthesis for HIPK4

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    HIPK4 for disorders           About MalaCards
    OMIM gene information: 611712    OMIM disorders: --


    HIPK4 for disorders           About GeneDecksing

    Genetic Association Database (GAD): HIPK4
    Human Genome Epidemiology (HuGE) Navigator: HIPK4 (2 documents)

    Export disorders for HIPK4 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for HIPK4 gene integrated from 9 sources:
    (articles sorted by number of sources associating them with HIPK4)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    3. Quantitative analysis of HSP90-client interactions rev eals principles of substrate recognition. (PubMed id 22939624)1 Taipale M....Lindquist S. (2012)
    4. A variant of the LRP4 gene affects the risk of chronic lymphocytic leukaemia transformation to Richter syndrome. (PubMed id 21121903)4 Rasi S....Rossi D. (2011)
    5. Single-nucleotide polymorphisms, acute rejection, and severity of tubulitis in kidney transplantation, accounting for center-to-center variation. (PubMed id 21085059)4 Israni A....Oetting W.S. (2010)
    6. Patterns of somatic mutation in human cancer genomes. (PubMed id 17344846)2 Greenman C.... Stratton M.R. (2007)
    7. Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9. (PubMed id 18022393)1 Arai S.... Kurokawa R. (2007)
    8. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)1 Strausberg R.L....Marra M.A. (2002)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 147746 HGNC: 19007 AceView: HIPK4 Ensembl:ENSG00000160396 euGenes: HUgn147746
    ECgene: HIPK4 H-InvDB: HIPK4

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for HIPK4 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for HIPK4 gene:
    Search GeneIP for patents involving HIPK4

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Browse Recombinant/Natural Proteins  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for HIPK4  
     OriGene qPCR primer pairs and template standards for HIPK4   Browse OriGene Protein Over-expression Lysates  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for HIPK4  
     OriGene qSTAR qPCR primer pairs in human, mouse for HIPK4   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for HIPK4   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for HIPK4   OriGene Custom Protein Services for HIPK4  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat HIPK4
     QIAGEN SeqTarget long-range PCR primers for resequencing HIPK4
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat HIPK4
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat HIPK4
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat HIPK4
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat HIPK4
     GenScript Custom Purified and Recombinant Proteins Services for HIPK4 GenScript cDNA clones with any tag delivered in your preferred vector for HIPK4
     GenScript Custom Assay Services for HIPK4 GenScript Custom Superior Antibodies Services for HIPK4
     GenScript Custom overexpressing Cell Line Services for HIPK4 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in HIPK4 promoter
     Search Chromatin IP Primers for HIPK4
     RT2 qPCR Primer Assay in human, mouse / rat HIPK4
     Search GNC Networks for HIPK4
     SABiosciences Custom PCR Arrays for HIPK4
     Search Tocris compounds for HIPK4
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological Cell Lysates
     cDNA Clones for HIPK4
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     HIPK4 antibodies
     HIPK4 proteins
     HIPK4 lysates
     Antibodies for HIPK4
     See all of Abcam's Antibodies, Kits and Proteins for HIPK4
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     Proteins for HIPK4
     Antibodies for HIPK4
     ELISAs for HIPK4
     CLIAs for HIPK4
     Search LifeMap BioReagents cell lines for HIPK4
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for HIPK4
     SwitchGear 3'UTR luciferase reporter plasmids for HIPK4
     SwitchGear Promoter luciferase reporter plasmids for HIPK4
     ThermoFisher Antibodies for HIPK4
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat HIPK4
     inGenious Targeting Laboratory - Custom generated mouse model solutions for HIPK4
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for HIPK4
    Customized:
     lentivirus for stable overexpression of HIPK4
     lentivirus expression plasmids for stable overexpression of HIPK4
     adenovirus for overexpression of HIPK4
     LSBio Antibodies in human, mouse, rat for HIPK4
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 4 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      HIPK4 gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 106 solr: 1.4