Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HIPK3 Gene

Aliases for HIPK3 Gene

  • Homeodomain Interacting Protein Kinase 3 2 3 5
  • Androgen Receptor-Interacting Nuclear Protein Kinase 3 4
  • Fas-Interacting Serine/Threonine-Protein Kinase 3 4
  • Homeodomain-Interacting Protein Kinase 3 2 3
  • Homolog Of Protein Kinase YAK1 3 4
  • EC 2.7.11.1 4 56
  • DYRK6 3 4

External Ids for HIPK3 Gene

Previous GeneCards Identifiers for HIPK3 Gene

  • GC11P034811
  • GC11P033957
  • GC11P033318
  • GC11P033272
  • GC11P033264
  • GC11P033235
  • GC11P032973

Summaries for HIPK3 Gene

GeneCards Summary for HIPK3 Gene

HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. Among its related pathways are Cellular senescence (KEGG). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.

UniProtKB/Swiss-Prot for HIPK3 Gene

  • Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).

Gene Wiki entry for HIPK3 Gene

Additional gene information for HIPK3 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK3 Gene

Genomics for HIPK3 Gene

GeneHancer (GH) Regulatory Elements for HIPK3 Gene

Promoters and enhancers for HIPK3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH11I033255 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 550.8 +1.7 1686 5.3 HDGF PKNOX1 SMAD1 ARNT ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2 HIPK3 TCP11L1 PIGCP1 GC11P033247 KIAA1549L
GH11I033159 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 12.9 -95.4 -95356 3.4 HDGF PKNOX1 SMAD1 MLX ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 CSTF3 CSTF3-AS1 NAT10 EIF3M QSER1 HIPK3 CAPRIN1 TCP11L1 PIGCP1 DEPDC7
GH11I033320 Enhancer 1.3 Ensembl ENCODE dbSUPER 12.1 +64.3 64324 1.6 HDAC1 PKNOX1 ARNT RAD21 TCF12 ATF7 IKZF2 PHF21A CEBPB NCOA1 HIPK3 TCP11L1 PIGCP1 KIAA1549L GC11P033247
GH11I033178 Enhancer 1 FANTOM5 Ensembl ENCODE 13.2 -77.8 -77772 1.7 ZFHX2 NFIC POLR2A L3MBTL2 SOX6 ATF2 MGA TCP11L1 HIPK3 CSTF3 ENSG00000206808 GC11M033171 GC11M033190 CSTF3-AS1 GC11M032953
GH11I033324 Enhancer 1 Ensembl ENCODE dbSUPER 12.2 +68.0 67956 0.3 PKNOX1 MZF1 EBF1 ZBTB8A ZFHX2 POLR2A GLIS1 PRDM10 EGR2 HIPK3 KIAA1549L GC11P033247
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around HIPK3 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the HIPK3 gene promoter:

Genomic Locations for HIPK3 Gene

Genomic Locations for HIPK3 Gene
chr11:33,256,672-33,357,023
(GRCh38/hg38)
Size:
100,352 bases
Orientation:
Plus strand
chr11:33,278,218-33,378,569
(GRCh37/hg19)

Genomic View for HIPK3 Gene

Genes around HIPK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK3 Gene

Proteins for HIPK3 Gene

  • Protein details for HIPK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H422-HIPK3_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 3
    Protein Accession:
    Q9H422
    Secondary Accessions:
    • O14632
    • Q2PBG4
    • Q2PBG5
    • Q92632
    • Q9HAS2

    Protein attributes for HIPK3 Gene

    Size:
    1215 amino acids
    Molecular mass:
    133743 Da
    Quaternary structure:
    • Interacts with Nkx1-2. Interacts with FAS and DAXX. Probably part of a complex consisting of HIPK3, FAS and FADD. Interacts with and stabilizes ligand-bound androgen receptor (AR) (By similarity). Interacts with UBL1/SUMO-1. Binds to NR5A1/SF1, SPEN/MINT and RUNX2.

    Alternative splice isoforms for HIPK3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HIPK3 Gene

Selected DME Specific Peptides for HIPK3 Gene

Q9H422:
  • HLLDFPHS
  • CGLKRKSEE
  • KSKEARKYIFN
  • SDTDEEE
  • ETLNHPF
  • EGDYQLVQHE
  • RVKVIDFGSAS
  • IRPILQQVATAL
  • EIVAIKILKNHPSYARQGQIEVSIL
  • NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
  • VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
  • EYDQIRYISQTQGLP

Post-translational modifications for HIPK3 Gene

Domains & Families for HIPK3 Gene

Gene Families for HIPK3 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for HIPK3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H422

UniProtKB/Swiss-Prot:

HIPK3_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK3: view

Function for HIPK3 Gene

Molecular function for HIPK3 Gene

GENATLAS Biochemistry:
homeodomain interacting protein kinase 3,highly expressed in heart and muscle tissue,localizing in nuclear speckles,corepressor for homeo domain transcription factors,maybe involved in cell cycle regulation,over-expressed in multidrugg resistant cell-lines
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).

Enzyme Numbers (IUBMB) for HIPK3 Gene

Phenotypes From GWAS Catalog for HIPK3 Gene

Gene Ontology (GO) - Molecular Function for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IDA,TAS 14766760
GO:0004674 protein serine/threonine kinase activity IDA,ISS 11034606
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with HIPK3: view
genes like me logo Genes that share phenotypes with HIPK3: view

Animal Model Products

miRNA for HIPK3 Gene

miRTarBase miRNAs that target HIPK3

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for HIPK3

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for HIPK3 Gene

Localization for HIPK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK3 Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK3 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 1
mitochondrion 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nuclear bodies (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol IDA --
GO:0016604 nuclear body IDA --
GO:0016605 PML body IEA --
genes like me logo Genes that share ontologies with HIPK3: view

Pathways & Interactions for HIPK3 Gene

SuperPathways for HIPK3 Gene

SuperPathway Contained pathways
1 Cellular senescence (KEGG)
genes like me logo Genes that share pathways with HIPK3: view

Pathways by source for HIPK3 Gene

1 KEGG pathway for HIPK3 Gene

Gene Ontology (GO) - Biological Process for HIPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
GO:0006468 protein phosphorylation IDA 14766760
GO:0006915 apoptotic process IEA --
GO:0009299 mRNA transcription IDA 17210646
genes like me logo Genes that share ontologies with HIPK3: view

No data available for SIGNOR curated interactions for HIPK3 Gene

Drugs & Compounds for HIPK3 Gene

(3) Drugs for HIPK3 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for HIPK3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with HIPK3: view

Transcripts for HIPK3 Gene

Unigene Clusters for HIPK3 Gene

Homeodomain interacting protein kinase 3:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for HIPK3

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK3 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b
SP1:
SP2: -

Relevant External Links for HIPK3 Gene

GeneLoc Exon Structure for
HIPK3
ECgene alternative splicing isoforms for
HIPK3

Expression for HIPK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK3 Gene



Protein tissue co-expression partners for HIPK3 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of HIPK3 Gene:

HIPK3

SOURCE GeneReport for Unigene cluster for HIPK3 Gene:

Hs.201918

mRNA Expression by UniProt/SwissProt for HIPK3 Gene:

Q9H422-HIPK3_HUMAN
Tissue specificity: Overexpressed in multidrug resistant cells. Highly expressed in heart and skeletal muscle, and at lower levels in placenta, pancreas, brain, spleen, prostate, thymus, testis, small intestine, colon and leukocytes. Not found in liver and lung.

Evidence on tissue expression from TISSUES for HIPK3 Gene

  • Heart(2.5)
  • Muscle(2.3)
  • Intestine(2)
  • Kidney(2)
genes like me logo Genes that share expression patterns with HIPK3: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK3 Gene

Orthologs for HIPK3 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK3 33 34
  • 99.75 (n)
dog
(Canis familiaris)
Mammalia HIPK3 33 34
  • 94.21 (n)
cow
(Bos Taurus)
Mammalia HIPK3 33 34
  • 93.31 (n)
mouse
(Mus musculus)
Mammalia Hipk3 33 16 34
  • 88.89 (n)
rat
(Rattus norvegicus)
Mammalia Hipk3 33
  • 88.83 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK3 34
  • 83 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia HIPK3 34
  • 82 (a)
OneToOne
chicken
(Gallus gallus)
Aves HIPK3 33 34
  • 80.56 (n)
lizard
(Anolis carolinensis)
Reptilia HIPK3 34
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hipk3 33
  • 72.59 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.10538 33
zebrafish
(Danio rerio)
Actinopterygii hipk3b 33 34
  • 67.08 (n)
hipk3a 34
  • 60 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta hipk 34
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea hpk-1 34
  • 40 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 34
  • 25 (a)
OneToMany
Species where no ortholog for HIPK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HIPK3 Gene

ENSEMBL:
Gene Tree for HIPK3 (if available)
TreeFam:
Gene Tree for HIPK3 (if available)

Paralogs for HIPK3 Gene

(2) SIMAP similar genes for HIPK3 Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with HIPK3: view

Variants for HIPK3 Gene

Sequence variations from dbSNP and Humsavar for HIPK3 Gene

SNP ID Clin Chr 11 pos Variation AA Info Type
rs1000013233 -- 33,283,085(+) C/G genic_upstream_transcript_variant, intron_variant
rs1000029878 -- 33,289,876(+) T/G intron_variant
rs1000049143 -- 33,272,299(+) T/C genic_upstream_transcript_variant, intron_variant
rs1000065164 -- 33,272,857(+) C/T genic_upstream_transcript_variant, intron_variant
rs1000067195 -- 33,290,186(+) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for HIPK3 Gene

Variant ID Type Subtype PubMed ID
dgv1093n100 CNV gain 25217958
dgv11n68 CNV gain 17160897
dgv1742n54 CNV gain 21841781
esv2677639 CNV deletion 23128226
esv2761660 CNV gain 21179565
esv2762904 CNV gain 21179565
esv3625876 CNV loss 21293372
esv3625877 CNV gain 21293372
esv3625878 CNV loss 21293372
esv3625879 CNV gain 21293372
esv3625880 CNV gain 21293372
nsv1045088 CNV gain 25217958
nsv1051437 CNV gain 25217958
nsv1054720 CNV gain 25217958
nsv1122604 CNV deletion 24896259
nsv1127173 CNV deletion 24896259
nsv467786 CNV gain 19166990
nsv521130 CNV gain 19592680
nsv951599 CNV duplication 24416366

Variation tolerance for HIPK3 Gene

Residual Variation Intolerance Score: 11.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.90; 59.22% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for HIPK3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK3 Gene

Disorders for HIPK3 Gene

Additional Disease Information for HIPK3

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for HIPK3 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK3 Gene

Publications for HIPK3 Gene

  1. Identification and sequence of human PKY, a putative kinase with increased expression in multidrug-resistant cells, with homology to yeast protein kinase Yak1. (PMID: 9373137) Begley DA … Abraham I (Gene 1997) 2 3 4 22 58
  2. Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation. (PMID: 17210646) Lan HC … Chung BC (Molecular and cellular biology 2007) 3 4 22 58
  3. JNK regulates HIPK3 expression and promotes resistance to Fas-mediated apoptosis in DU 145 prostate carcinoma cells. (PMID: 14766760) Curtin JF … Cotter TG (The Journal of biological chemistry 2004) 3 4 22 58
  4. An approach based on a genome-wide association study reveals candidate loci for narcolepsy. (PMID: 20677014) Shimada M … Tokunaga K (Human genetics 2010) 3 44 58
  5. MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia. (PMID: 20347265) Xu Y … Liu P (Schizophrenia research 2010) 3 44 58

Products for HIPK3 Gene

  • Addgene plasmids for HIPK3

Sources for HIPK3 Gene

Content
Loading form....