Aliases for HIPK3 Gene
Aliases for HIPK3 Gene
External Ids for HIPK3 Gene
- HGNC: 4915
- Entrez Gene: 10114
- Ensembl: ENSG00000110422
- OMIM: 604424
- UniProtKB: Q9H422
Previous GeneCards Identifiers for HIPK3 Gene
- GC11P034811
- GC11P033957
- GC11P033318
- GC11P033272
- GC11P033264
- GC11P033235
- GC11P032973
Summaries for HIPK3 Gene
GeneCards Summary for HIPK3 Gene
HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.
UniProtKB/Swiss-Prot for HIPK3 Gene
-
Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).
No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK3 Gene
Genomics for HIPK3 Gene
Regulatory Elements for HIPK3 Gene
Enhancers for HIPK3 Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH11G033939 | 2.4 | VISTA FANTOM5 Ensembl ENCODE dbSUPER | 10.5 | +686.5 | 686478 | 6.3 | HDGF PKNOX1 CREB3L1 ARNT ZNF766 CBX5 FOS KLF13 JUNB REST | HIPK3 GC11P033942 GC11P034049 |
| GH11G033320 | 1.4 | Ensembl ENCODE dbSUPER | 12.1 | +64.3 | 64324 | 1.6 | HDAC1 PKNOX1 TBL1XR1 ARNT RAD21 TCF12 GATA2 IKZF2 CEBPB JUNB | HIPK3 TCP11L1 PIGCP1 KIAA1549L |
| GH11G033255 | 1.4 | ENCODE dbSUPER | 11.2 | +1.7 | 1687 | 5.3 | HDGF PKNOX1 ARNT AGO1 ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2 | HIPK3 TCP11L1 PIGCP1 KIAA1549L |
| GH11G033178 | 1.1 | FANTOM5 Ensembl ENCODE | 13.2 | -77.8 | -77773 | 1.7 | L3MBTL2 ATF2 EP300 NFIC ZFHX2 ZNF366 FOS SP7 MGA | TCP11L1 HIPK3 CSTF3 ENSG00000206808 GC11M033171 GC11M033190 |
| GH11G033159 | 1.1 | ENCODE | 12.9 | -95.4 | -95356 | 3.4 | HDGF PKNOX1 MLX CREB3L1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 | HIPK3 EIF3M NAT10 CSTF3 TCP11L1 PIGCP1 DEPDC7 CSTF3-AS1 PIR59958 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around HIPK3 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for HIPK3 Gene
- Chromosome:
- 11
- Start:
- 33,256,672 bp from pter
- End:
- 33,357,023 bp from pter
- Size:
- 100,352 bases
- Orientation:
- Plus strand
Genomic View for HIPK3 Gene
Genes around HIPK3 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 11p13 by Ensembl
- 11p13 by Entrez Gene
- 11p13 by HGNC
HIPK3 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for HIPK3 Gene
Proteins for HIPK3 Gene
-
Protein details for HIPK3 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9H422-HIPK3_HUMAN
- Recommended name:
- Homeodomain-interacting protein kinase 3
- Protein Accession:
- Q9H422
- O14632
- Q2PBG4
- Q2PBG5
- Q92632
- Q9HAS2
Protein attributes for HIPK3 Gene
- Size:
- 1215 amino acids
- Molecular mass:
- 133743 Da
- Quaternary structure:
-
- Interacts with Nkx1-2. Interacts with FAS and DAXX. Probably part of a complex consisting of HIPK3, FAS and FADD. Interacts with and stabilizes ligand-bound androgen receptor (AR) (By similarity). Interacts with UBL1/SUMO-1. Binds to NR5A1/SF1, SPEN/MINT and RUNX2.
Protein Expression for HIPK3 Gene
Selected DME Specific Peptides for HIPK3 Gene
- Q9H422:
-
- HLLDFPHS
- CGLKRKSEE
- KSKEARKYIFN
- SDTDEEE
- ETLNHPF
- EGDYQLVQHE
- RVKVIDFGSAS
- IRPILQQVATAL
- EIVAIKILKNHPSYARQGQIEVSIL
- NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
- VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
- EYDQIRYISQTQGLP
Post-translational modifications for HIPK3 Gene
- Autophosphorylated, but autophosphorylation is not required for catalytic activity.
- May be sumoylated.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for HIPK3 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for HIPK3
- Novus Biologicals Antibodies for HIPK3
- Invitrogen Antibodies for HIPK3
- antibodies-online Antibodies for HIPK3: See all 55
- GeneTex HIPK3 antibody for HIPK3
Protein Products
- EMD Millipore Purified and/or Recombinant HIPK3 Protein
-
OriGene Purified Proteins for HIPK3
- Search Origene for MassSpec and Protein Over-expression Lysates for HIPK3
- Origene Custom Protein Services for HIPK3
- Novus Biologicals proteins for HIPK3
-
Cloud-Clone Corp. Proteins for HIPK3
- antibodies-online Proteins for HIPK3: See all 4
- Search antibodies-online for peptides
- Search GeneTex for Proteins for HIPK3
Assay Products
Domains & Families for HIPK3 Gene
Gene Families for HIPK3 Gene
Protein Domains for HIPK3 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for HIPK3 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q9H422UniProtKB/Swiss-Prot:
HIPK3_HUMAN :- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Function for HIPK3 Gene
Molecular function for HIPK3 Gene
- GENATLAS Biochemistry:
- homeodomain interacting protein kinase 3,highly expressed in heart and muscle tissue,localizing in nuclear speckles,corepressor for homeo domain transcription factors,maybe involved in cell cycle regulation,over-expressed in multidrugg resistant cell-lines
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).
Enzyme Numbers (IUBMB) for HIPK3 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | TAS,IDA | 14766760 |
| GO:0004674 | protein serine/threonine kinase activity | IDA,ISS | 11034606 |
| GO:0005524 | ATP binding | IEA | -- |
| GO:0016301 | kinase activity | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
Phenotypes for HIPK3 Gene
- MGI mutant phenotypes for HIPK3:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for HIPK3:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased viability ratio
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection
- Increased transferrin (TF) endocytosis
- Increased G1 DNA content
- Decreased viability
- Decreased cell migration
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection after viral supernatant infection
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection after direct virus infection
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased cell migration
- Condensed cis-Golgi
- Decreased Hepatitis C Virus pseudoparticles (HCVpp
Animal Model Products
-
Taconic Biosciences Mouse Models for HIPK3
-
ViGene Biosciences lentiviral particle packaged cDNA for HIPK3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK3 gene
- Search ViGene Biosciences for HIPK3
CRISPR Products
-
OriGene CRISPR knockouts for HIPK3
-
Santa Cruz Biotechnology (SCBT) CRISPR for HIPK3
- GenScript: Design CRISPR guide RNA sequences for HIPK3
miRNA for HIPK3 Gene
- miRTarBase miRNAs that target HIPK3
-
- hsa-mir-20b-5p (MIRT001782)
- hsa-mir-106a-5p (MIRT001837)
- hsa-mir-21-5p (MIRT002419)
- hsa-mir-19b-3p (MIRT004064)
- hsa-mir-92a-3p (MIRT004090)
- hsa-mir-335-5p (MIRT018461)
- hsa-mir-124-3p (MIRT022918)
- hsa-mir-1-3p (MIRT023984)
- hsa-mir-187-3p (MIRT438276)
- hsa-mir-197-3p (MIRT569902)
- hsa-mir-4999-3p (MIRT569903)
- hsa-mir-6884-3p (MIRT569904)
- hsa-mir-3613-3p (MIRT569905)
- hsa-mir-181c-3p (MIRT569906)
- hsa-mir-6776-3p (MIRT569907)
- hsa-mir-342-3p (MIRT611504)
- hsa-mir-6892-3p (MIRT611505)
- hsa-mir-4717-3p (MIRT611506)
- hsa-mir-548z (MIRT611507)
- hsa-mir-548h-3p (MIRT611508)
- hsa-mir-548d-3p (MIRT611509)
- hsa-mir-548bb-3p (MIRT611510)
- hsa-mir-548ac (MIRT611511)
- hsa-mir-4645-3p (MIRT702942)
- hsa-mir-196b-3p (MIRT702943)
- hsa-mir-520h (MIRT702944)
- hsa-mir-520g-3p (MIRT702945)
- hsa-mir-3973 (MIRT702946)
- hsa-mir-4760-3p (MIRT702947)
- hsa-mir-548ah-5p (MIRT702948)
- hsa-mir-3609 (MIRT702949)
- hsa-mir-655-3p (MIRT702950)
- hsa-mir-374c-5p (MIRT702951)
- hsa-mir-5009-5p (MIRT725439)
- hsa-mir-8058 (MIRT725440)
- hsa-mir-6071 (MIRT725441)
- hsa-mir-6828-3p (MIRT725442)
- hsa-mir-6505-3p (MIRT725443)
- hsa-mir-7106-3p (MIRT725444)
- hsa-mir-422a (MIRT725445)
- hsa-mir-378h (MIRT725446)
- hsa-mir-378i (MIRT725447)
- hsa-mir-378f (MIRT725448)
- hsa-mir-378e (MIRT725449)
- hsa-mir-378c (MIRT725450)
- hsa-mir-378d (MIRT725451)
- hsa-mir-378b (MIRT725452)
- hsa-mir-378a-3p (MIRT725453)
- hsa-mir-2116-3p (MIRT725454)
- hsa-mir-767-3p (MIRT725455)
- hsa-mir-3654 (MIRT725456)
- hsa-mir-224-5p (MIRT725457)
- hsa-mir-19a-3p (MIRT727495)
miRNA Products
- Search ViGene Biosciences for HIPK3
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HIPK3
- Browse OriGene Inhibitory RNA Products For HIPK3
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK3 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HIPK3
Cell Line Products
-
Horizon Cell Lines for HIPK3
-
ViGene Biosciences adenoviral particle packaged cDNA for HIPK3 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for HIPK3 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK3 gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for HIPK3 Gene
Localization for HIPK3 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HIPK3 Gene
- Cytoplasm. Nucleus.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| plasma membrane | 1 |
| mitochondrion | 1 |
| endoplasmic reticulum | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA | -- |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005829 | cytosol | IDA | -- |
| GO:0016604 | nuclear body | IDA | -- |
| GO:0016605 | PML body | IEA | -- |
Pathways & Interactions for HIPK3 Gene
No Data Available
Interacting Proteins for HIPK3 Gene
Selected Interacting proteins:
ENSP00000304226
Q9H422-HIPK3_HUMAN
for HIPK3 Gene via
STRING
MINT
IID
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006351 | transcription, DNA-templated | IEA | -- |
| GO:0006355 | regulation of transcription, DNA-templated | IEA | -- |
| GO:0006468 | protein phosphorylation | IDA | 14766760 |
| GO:0006915 | apoptotic process | IEA | -- |
| GO:0009299 | mRNA transcription | IDA | 17210646 |
No data available for Pathways by source and SIGNOR curated interactions for HIPK3 Gene
Drugs & Compounds for HIPK3 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Adenosine triphosphate | Approved | Nutra | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for HIPK3 Gene
mRNA/cDNA for HIPK3 Gene
- (7) REFSEQ mRNAs :
- (7) Additional mRNA sequences :
- (122) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for HIPK3 Gene
CRISPR Products
-
OriGene CRISPR knockouts for HIPK3
-
Santa Cruz Biotechnology (SCBT) CRISPR for HIPK3
- GenScript: Design CRISPR guide RNA sequences for HIPK3
miRNA Products
- Search ViGene Biosciences for HIPK3
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HIPK3
- Browse OriGene Inhibitory RNA Products For HIPK3
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK3 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HIPK3
Flow Cytometry Products
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16a | · | 16b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | |||||||||||||||||||||||||||||||||
| SP2: | - |
Expression for HIPK3 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Limb (Muscoskeletal System)
- Mesenchymal Condensate Cells Zeugopod
- Autopod
- Zeugopod
- Bone (Muscoskeletal System)
-
Cartilage (Muscoskeletal System)
- Mesenchymal Condensate Cells Zeugopod
- Gut Tube (Gastrointestinal Tract)
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK3 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of HIPK3 Gene:
HIPK3SOURCE GeneReport for Unigene cluster for HIPK3 Gene:
Hs.201918mRNA Expression by UniProt/SwissProt for HIPK3 Gene:
Q9H422-HIPK3_HUMAN
Tissue specificity:
Overexpressed in multidrug resistant cells. Highly expressed in heart and skeletal muscle, and at lower levels in placenta, pancreas, brain, spleen, prostate, thymus, testis, small intestine, colon and leukocytes. Not found in liver and lung.
Evidence on tissue expression from TISSUES for HIPK3 Gene
- Heart(2.5)
- Muscle(2.3)
- Intestine(2)
- Kidney(2)
Primer Products
-
OriGene qPCR primer pairs for HIPK3
No data available for mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK3 Gene
Orthologs for HIPK3 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | HIPK3 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | HIPK3 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | HIPK3 34 35 |
|
||
| mouse (Mus musculus) |
Mammalia | Hipk3 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Hipk3 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | HIPK3 35 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | HIPK3 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | HIPK3 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | HIPK3 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | hipk3 34 |
|
||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.10538 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | hipk3b 34 35 |
|
||
| hipk3a 35 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | hipk 35 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | hpk-1 35 |
|
OneToMany | |
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YAK1 35 |
|
OneToMany |
- Species where no ortholog for HIPK3 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for HIPK3 Gene
Variants for HIPK3 Gene
| SNP ID | Clin | Chr 11 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000013233 | -- | 33,283,085(+) | AGATG(C/G)CAATG | intron-variant | |
| rs1000029878 | -- | 33,289,876(+) | TGTTT(G/T)AATTT | intron-variant | |
| rs1000049143 | -- | 33,272,299(+) | GAGGC(C/T)GAGGC | intron-variant | |
| rs1000065164 | -- | 33,272,857(+) | CTGTC(C/T)CCTGT | intron-variant | |
| rs1000067195 | -- | 33,290,186(+) | TGTAT(A/G)GGTTT | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1093n100 | CNV | gain | 25217958 |
| dgv11n68 | CNV | gain | 17160897 |
| dgv1742n54 | CNV | gain | 21841781 |
| esv2677639 | CNV | deletion | 23128226 |
| esv2761660 | CNV | gain | 21179565 |
| esv2762904 | CNV | gain | 21179565 |
| esv3625876 | CNV | loss | 21293372 |
| esv3625877 | CNV | gain | 21293372 |
| esv3625878 | CNV | loss | 21293372 |
| esv3625879 | CNV | gain | 21293372 |
| esv3625880 | CNV | gain | 21293372 |
| nsv1045088 | CNV | gain | 25217958 |
| nsv1051437 | CNV | gain | 25217958 |
| nsv1054720 | CNV | gain | 25217958 |
| nsv1122604 | CNV | deletion | 24896259 |
| nsv1127173 | CNV | deletion | 24896259 |
| nsv467786 | CNV | gain | 19166990 |
| nsv521130 | CNV | gain | 19592680 |
| nsv951599 | CNV | duplication | 24416366 |
Residual Variation Intolerance Score:
11.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.90;
59.22% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for HIPK3 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- HIPK3
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK3 Gene
Disorders for HIPK3 Gene
Relevant External Links for HIPK3
No disorders were found for HIPK3 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK3 Gene
Publications for HIPK3 Gene
- Identification and sequence of human PKY, a putative kinase with increased expression in multidrug-resistant cells, with homology to yeast protein kinase Yak1. (PMID: 9373137) Begley D.A. … Abraham I. (Gene 1997) 2 3 4 22 64
- Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation. (PMID: 17210646) Lan H.-C. … Chung B.-C. (Mol. Cell. Biol. 2007) 3 4 22 64
- JNK regulates HIPK3 expression and promotes resistance to Fas- mediated apoptosis in DU 145 prostate carcinoma cells. (PMID: 14766760) Curtin J.F. … Cotter T.G. (J. Biol. Chem. 2004) 3 4 22 64
- MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia. (PMID: 20347265) Xu Y. … Liu P. (Schizophr. Res. 2010) 3 46 64
- An approach based on a genome-wide association study reveals candidate loci for narcolepsy. (PMID: 20677014) Shimada M. … Tokunaga K. (Hum. Genet. 2010) 3 46 64
Products for HIPK3 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for HIPK3
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HIPK3
- Search Origene for MassSpec and Protein Over-expression Lysates for HIPK3
- Origene Custom Protein Services for HIPK3
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HIPK3
- Browse OriGene Inhibitory RNA Products For HIPK3
- OriGene qPCR primer pairs for HIPK3
- OriGene CRISPR knockouts for HIPK3
- OriGene ORF clones in human for HIPK3
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HIPK3
- GenScript: Next-day shipping cDNA ORF clone for HIPK3 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for HIPK3
- GenScript Custom Assay Services for HIPK3
- GenScript Custom overexpressing Cell Line Services for HIPK3
- GenScript: Design CRISPR guide RNA sequences for HIPK3
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for HIPK3
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for HIPK3
- Novus Biologicals proteins for HIPK3
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies at Cloud-Clone Corp.
- Cloud-Clone Corp. Proteins for HIPK3
- Browse Assay Kits at Cloud-Clone Corp.
- Taconic Biosciences Mouse Models for HIPK3
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Addgene plasmids for HIPK3
- antibodies-online Antibodies for HIPK3: See all 55
- Search antibodies-online for kits
- antibodies-online Proteins for HIPK3: See all 4
- Search antibodies-online for peptides
- GeneTex HIPK3 antibody for HIPK3
- Search GeneTex for Proteins for HIPK3
- ViGene Biosciences adenoviral particle packaged cDNA for HIPK3 gene
- ViGene Biosciences lentiviral particle packaged cDNA for HIPK3 gene
- ViGene Biosciences ready-to-package AAV shRNAs for HIPK3 gene
- Search ViGene Biosciences for HIPK3
- Search Santa Cruz Biotechnology (SCBT) for HIPK3 Antibodies
- Search Santa Cruz Biotechnology (SCBT) for HIPK3 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for HIPK3
- Horizon Cell Lines for HIPK3
- Cyagen custom Knockout/knockin (KOKI) mouse models for HIPK3
- VectorBuilder custom plasmid, inducible vectors for HIPK3
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for HIPK3
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for HIPK3 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer