Free for academic non-profit institutions. Other users need a Commercial license

HIPK2 Gene(Protein Coding)

Homeodomain Interacting Protein Kinase 2

GCID:
GC07M139561
GIFtS:
63
Genes Participants
UDN Logo

Aliases for HIPK2 Gene

Aliases for HIPK2 Gene

  • Homeodomain Interacting Protein Kinase 2 2 3 5
  • Homeodomain-Interacting Protein Kinase 2 2 3
  • EC 2.7.11.1 4 61
  • HHIPk2 3 4
  • PRO0593 3

External Ids for HIPK2 Gene

Previous GeneCards Identifiers for HIPK2 Gene

  • GC07M137598
  • GC07M138657
  • GC07M138671
  • GC07M138714
  • GC07M138907
  • GC07M139246
  • GC07M133556

Summaries for HIPK2 Gene

Entrez Gene Summary for HIPK2 Gene

  • This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

GeneCards Summary for HIPK2 Gene

HIPK2 (Homeodomain Interacting Protein Kinase 2) is a Protein Coding gene. Diseases associated with HIPK2 include Hypoxia and Pilocytic Astrocytoma. Among its related pathways are Regulation of TP53 Activity and Apoptosis and Autophagy. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK1.

UniProtKB/Swiss-Prot for HIPK2 Gene

  • Serine/threonine-protein kinase involved in transcription regulation, p53/TP53-mediated cellular apoptosis and regulation of the cell cycle. Acts as a corepressor of several transcription factors, including SMAD1 and POU4F1/Brn3a and probably NK homeodomain transcription factors. Phosphorylates PDX1, ATF1, PML, p53/TP53, CREB1, CTBP1, CBX4, RUNX1, EP300, CTNNB1, HMGA1 and ZBTB4. Inhibits cell growth and promotes apoptosis through the activation of p53/TP53 both at the transcription level and at the protein level (by phosphorylation and indirect acetylation). The phosphorylation of p53/TP53 may be mediated by a p53/TP53-HIPK2-AXIN1 complex. Involved in the response to hypoxia by acting as a transcriptional co-suppressor of HIF1A. Mediates transcriptional activation of TP73. In response to TGFB, cooperates with DAXX to activate JNK. Negative regulator through phosphorylation and subsequent proteasomal degradation of CTNNB1 and the antiapoptotic factor CTBP1. In the Wnt/beta-catenin signaling pathway acts as an intermediate kinase between MAP3K7/TAK1 and NLK to promote the proteasomal degradation of MYB. Phosphorylates CBX4 upon DNA damage and promotes its E3 SUMO-protein ligase activity. Activates CREB1 and ATF1 transcription factors by phosphorylation in response to genotoxic stress. In response to DNA damage, stabilizes PML by phosphorylation. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation. Promotes angiogenesis, and is involved in erythroid differentiation, especially during fetal liver erythropoiesis. Phosphorylation of RUNX1 and EP300 stimulates EP300 transcription regulation activity. Triggers ZBTB4 protein degradation in response to DNA damage. Modulates HMGA1 DNA-binding affinity. In response to high glucose, triggers phosphorylation-mediated subnuclear localization shifting of PDX1. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis.

Gene Wiki entry for HIPK2 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK2 Gene

Genomics for HIPK2 Gene

Products:

  1. Regulatory Element

Regulatory Elements for HIPK2 Gene

Enhancers for HIPK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07G139851 1.9 FANTOM5 Ensembl ENCODE dbSUPER 17.7 -76.4 -76386 5.0 HDGF PKNOX1 TCF12 ZNF766 CBX5 GATA2 ELK1 FOS MCM3 CAVIN1 TBXAS1 HIPK2 KDM7A GC07P139864
GH07G139724 1.9 FANTOM5 Ensembl ENCODE dbSUPER 16.9 +45.8 45751 15.0 HDGF FOXA2 PKNOX1 ZFP64 ARID4B SIN3A FEZF1 ZNF2 YY1 ZNF143 TBXAS1 HIPK2 FCF1P11 TTC26 ZC3HAV1L PARP12 KDM7A TMEM213 KIAA1549 LUC7L2
GH07G139739 1.4 Ensembl ENCODE dbSUPER 18.1 +37.0 37029 1.9 ELF3 TBP FOXA2 MLX ARID4B FEZF1 THRB ZNF48 ZSCAN9 RAD21 HIPK2 TBXAS1 PIR36040 LOC105375530
GH07G139647 1.8 FANTOM5 Ensembl ENCODE dbSUPER 13.2 +129.5 129494 3.6 PKNOX1 ZFP64 YY1 ZNF121 GATA2 ZNF202 SP3 JUNB REST ZNF623 TTC26 LOC100499191 TBXAS1 HIPK2 ZC3HAV1L KDM7A LOC105375530 PIR36040
GH07G139679 1.9 FANTOM5 Ensembl ENCODE dbSUPER 11.5 +95.9 95882 5.8 HDGF ATF1 MLX ZFP64 SIN3A YY1 GATA2 FOS SP5 PPARG TBXAS1 HIPK2 ERHP1 CLEC2L KDM7A PIR36040 LOC105375530
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around HIPK2 on UCSC Golden Path with GeneCards custom track

Promoters for HIPK2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000218988 394 3001 HDGF CREB3L1 ARNT SIN3A ZNF2 YY1 ZNF207 ZNF263 SP3 REST

Transcription factor binding sites by QIAGEN in the HIPK2 gene promoter:

Genomic Location for HIPK2 Gene

Chromosome:
7
Start:
139,561,570 bp from pter
End:
139,777,894 bp from pter
Size:
216,325 bases
Orientation:
Minus strand

Genomic View for HIPK2 Gene

Genes around HIPK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK2 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for HIPK2 Gene

Proteins for HIPK2 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for HIPK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H2X6-HIPK2_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 2
    Protein Accession:
    Q9H2X6
    Secondary Accessions:
    • Q75MR7
    • Q8WWI4
    • Q9H2Y1

    Protein attributes for HIPK2 Gene

    Size:
    1198 amino acids
    Molecular mass:
    130966 Da
    Quaternary structure:
    • Interacts with CREB1, SIAH1, WSB1, CBX4, TRADD, p53/TP53, TP73, TP63, CREBBP, DAXX, P53DINP1, SKI, SMAD1, SMAD2 and SMAD3, but not SMAD4. Interacts with ATF1, PML, RUNX1, EP300, NKX1-2, NKX2-5, SPN/CD43, UBE2I, HMGA1, CTBP1, AXIN1, NLK, MYB, POU4F1, POU4F2, POU4F3, UBE2I, UBL1 and ZBTB4. Probably part of a complex consisting of p53/TP53, HIPK2 and AXIN1. Interacts with SP100; positively regulates TP53-dependent transcription.
    Miscellaneous:
    • Interesting targets for cancer therapy. HIPK2 deregulation would end up in a multifactorial response leading to tumor chemoresistance by affecting p53/TP53 activity on one hand and to angiogenesis and cell proliferation by affecting HIF1A activity on the other hand. May provide important insights in the process of tumor progression, and may also serve as the crucial point in the diagnostic and therapeutical aspects of cancer. Tumor treatment may potential be improved by zinc supplementation in combination with chemotherapy to address hypoxia (PubMed:20514025).

    Alternative splice isoforms for HIPK2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HIPK2 Gene

Protein Expression for HIPK2 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for HIPK2 Gene

Q9H2X6:
  • THVAPSTSTNLTM
  • HLLDFPHS
  • CGLKRKSEE
  • KSKEARKYIFN
  • SDTDEEE
  • ETLNHPF
  • EGDYQLVQHE
  • RVKVIDFGSAS
  • EIVAIKILKNHPSYARQGQIEVSIL
  • IRPVLQQVATAL
  • NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
  • VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
  • EYDQIRYISQTQGLP

Post-translational modifications for HIPK2 Gene

  • Autophosphorylation at Tyr-361 in the activation loop activates the kinase and promotes nuclear localization.
  • Cleaved at Asp-923 and Asp-984 by CASP6 in a p53/TP53-dependent manner. The cleaved form lacks the autoinhibitory C-terminal domain (AID), resulting in a hyperactive kinase, which potentiates p53/TP53 Ser-46 phosphorylation and subsequent activation of the cell death machinery.
  • Sumoylated. When conjugated it is directed to nuclear speckles. Desumoylated by SENP1 (By similarity). Sumoylation on Lys-32 is promoted by the E3 SUMO-protein ligase CBX4.
  • Ubiquitinated by FBXO3, WSB1 and SIAH1, leading to rapid proteasome-dependent degradation. The degradation mediated by FBXO3, but not ubiquitination, is prevented in the presence of PML. The degradation mediated by WSB1 and SIAH1 is reversibly reduced upon DNA damage.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for HIPK2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for HIPK2 (HIPK2)
  • Abcam antibodies for HIPK2
  • Cloud-Clone Corp. Antibodies for HIPK2
  • Santa Cruz Biotechnology (SCBT) Antibodies for HIPK2

Domains & Families for HIPK2 Gene

Gene Families for HIPK2 Gene

IUPHAR :

Protein Domains for HIPK2 Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for HIPK2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H2X6

UniProtKB/Swiss-Prot:

HIPK2_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK2: view

Function for HIPK2 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for HIPK2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in transcription regulation, p53/TP53-mediated cellular apoptosis and regulation of the cell cycle. Acts as a corepressor of several transcription factors, including SMAD1 and POU4F1/Brn3a and probably NK homeodomain transcription factors. Phosphorylates PDX1, ATF1, PML, p53/TP53, CREB1, CTBP1, CBX4, RUNX1, EP300, CTNNB1, HMGA1 and ZBTB4. Inhibits cell growth and promotes apoptosis through the activation of p53/TP53 both at the transcription level and at the protein level (by phosphorylation and indirect acetylation). The phosphorylation of p53/TP53 may be mediated by a p53/TP53-HIPK2-AXIN1 complex. Involved in the response to hypoxia by acting as a transcriptional co-suppressor of HIF1A. Mediates transcriptional activation of TP73. In response to TGFB, cooperates with DAXX to activate JNK. Negative regulator through phosphorylation and subsequent proteasomal degradation of CTNNB1 and the antiapoptotic factor CTBP1. In the Wnt/beta-catenin signaling pathway acts as an intermediate kinase between MAP3K7/TAK1 and NLK to promote the proteasomal degradation of MYB. Phosphorylates CBX4 upon DNA damage and promotes its E3 SUMO-protein ligase activity. Activates CREB1 and ATF1 transcription factors by phosphorylation in response to genotoxic stress. In response to DNA damage, stabilizes PML by phosphorylation. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation. Promotes angiogenesis, and is involved in erythroid differentiation, especially during fetal liver erythropoiesis. Phosphorylation of RUNX1 and EP300 stimulates EP300 transcription regulation activity. Triggers ZBTB4 protein degradation in response to DNA damage. Modulates HMGA1 DNA-binding affinity. In response to high glucose, triggers phosphorylation-mediated subnuclear localization shifting of PDX1. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis.
UniProtKB/Swiss-Prot Induction:
Unstable in unstressed cells but stabilized upon DNA damage. Induced by UV irradiation and other genotoxic agents (adriamycin ADR, cisplatin CDDP, etoposide, IR, roscovitin), thus triggering p53/TP53 apoptotic response. Consistutively negatively regulated by SIAH1 and WSB1 through proteasomal degradation. This negative regulation is impaired upon genotoxic stress. Repressed upon hypoxia (often associated with tumors), through MDM2- (an E3 ubiquitin ligases) mediated proteasomal degradation, thus inactivating p53/TP53 apoptotic response. This hypoxia repression is reversed by zinc. The stabilization mediated by DNA damage requires the damage checkpoint kinases ATM and ATR.

Enzyme Numbers (IUBMB) for HIPK2 Gene

Gene Ontology (GO) - Molecular Function for HIPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0001102 RNA polymerase II activating transcription factor binding ISS --
GO:0001105 contributes_to RNA polymerase II transcription coactivator activity ISS --
GO:0003714 transcription corepressor activity TAS,IDA 12874272
GO:0004672 protein kinase activity IEA,IDA 19448668
genes like me logo Genes that share ontologies with HIPK2: view
genes like me logo Genes that share phenotypes with HIPK2: view

Animal Models for HIPK2 Gene

MGI Knock Outs for HIPK2:

Animal Model Products

  • Taconic Biosciences Mouse Models for HIPK2

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HIPK2 Gene

Localization for HIPK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK2 Gene

Nucleus, PML body. Cytoplasm. Note=Concentrated in PML/POD/ND10 nuclear bodies. Small amounts are cytoplasmic.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK2 gene
Compartment Confidence
nucleus 5
cytosol 2
extracellular 1

Gene Ontology (GO) - Cellular Components for HIPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,TAS 12220523
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm ISS --
GO:0016604 nuclear body TAS 14626429
GO:0016605 colocalizes_with PML body IDA,IEA 14647468
genes like me logo Genes that share ontologies with HIPK2: view

Pathways & Interactions for HIPK2 Gene

genes like me logo Genes that share pathways with HIPK2: view

Pathways by source for HIPK2 Gene

1 Sino Biological pathway for HIPK2 Gene
3 Cell Signaling Technology pathways for HIPK2 Gene
1 R&D Systems pathway for HIPK2 Gene
2 Qiagen pathways for HIPK2 Gene

SIGNOR curated interactions for HIPK2 Gene

Activates:
Inactivates:
Is inactivated by:

Gene Ontology (GO) - Biological Process for HIPK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter IEA --
GO:0001654 eye development ISS 20579985
GO:0001934 positive regulation of protein phosphorylation IEA --
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
genes like me logo Genes that share ontologies with HIPK2: view

Drugs & Compounds for HIPK2 Gene

Products:

  1. Drug

(5) Drugs for HIPK2 Gene - From: DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Vadimezan Pharma Vascular disrupting agents (VDA) 18

(1) Additional Compounds for HIPK2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with HIPK2: view

Transcripts for HIPK2 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for HIPK2 Gene

(9) REFSEQ mRNAs :
(12) Additional mRNA sequences :
(21) Selected AceView cDNA sequences:
(3) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for HIPK2 Gene

Homeodomain interacting protein kinase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK2 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13a · 13b ^ 14 ^ 15
SP1: - -
SP2: -
SP3:

Relevant External Links for HIPK2 Gene

GeneLoc Exon Structure for
HIPK2
ECgene alternative splicing isoforms for
HIPK2

Expression for HIPK2 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK2 Gene

mRNA expression in normal human tissues for HIPK2 Gene
mRNA expression by BioGPS for HIPK2 GenemRNA expression by GTEx for HIPK2 Gene

mRNA differential expression in normal tissues according to GTEx for HIPK2 Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x5.7), Brain - Amygdala (x5.0), Brain - Substantia nigra (x4.6), Brain - Hippocampus (x4.4), and Brain - Putamen (basal ganglia) (x4.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK2 Gene



NURSA nuclear receptor signaling pathways regulating expression of HIPK2 Gene:

HIPK2

SOURCE GeneReport for Unigene cluster for HIPK2 Gene:

Hs.731417

mRNA Expression by UniProt/SwissProt for HIPK2 Gene:

Q9H2X6-HIPK2_HUMAN
Tissue specificity: Highly expressed in heart, muscle and kidney. Weakly expressed in a ubiquitous way. Down-regulated in several thyroid and breast tumors.

Evidence on tissue expression from TISSUES for HIPK2 Gene

  • Nervous system(5)
  • Liver(4.4)
  • Kidney(2.7)
  • Pancreas(2.2)
  • Heart(2)
genes like me logo Genes that share expression patterns with HIPK2: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK2 Gene

Orthologs for HIPK2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia HIPK2 34 35
  • 99.5 (n)
cow
(Bos Taurus)
 Mammalia HIPK2 35
  • 96 (a)
 OneToOne
oppossum
(Monodelphis domestica)
 Mammalia HIPK2 35
  • 95 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia HIPK2 34 35
  • 92.8 (n)
mouse
(Mus musculus)
 Mammalia Hipk2 34 16 35
  • 90.99 (n)
rat
(Rattus norvegicus)
 Mammalia Hipk2 34
  • 90.93 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia HIPK2 35
  • 79 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves HIPK2 34 35
  • 84.76 (n)
lizard
(Anolis carolinensis)
 Reptilia HIPK2 35
  • 93 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia hipk2 34
  • 75.57 (n)
Str.10767 34
zebrafish
(Danio rerio)
 Actinopterygii hipk2 34 35
  • 76.23 (n)
wufk56d12 34
fruit fly
(Drosophila melanogaster)
 Insecta CG17090 36
  • 55 (a)
hipk 35
  • 34 (a)
 OneToMany
worm
(Caenorhabditis elegans)
 Secernentea hpk-1 35
  • 41 (a)
 OneToMany
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes YAK1 35
  • 25 (a)
 OneToMany
Species where no ortholog for HIPK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HIPK2 Gene

ENSEMBL:
Gene Tree for HIPK2 (if available)
TreeFam:
Gene Tree for HIPK2 (if available)

Paralogs for HIPK2 Gene

Paralogs for HIPK2 Gene

(7) SIMAP similar genes for HIPK2 Gene using alignment to 4 proteins:

genes like me logo Genes that share paralogs with HIPK2: view

Variants for HIPK2 Gene

Sequence variations from dbSNP and Humsavar for HIPK2 Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs1000008063 -- 139,726,430(+) GGGTG(C/G)CAGAA intron-variant
rs1000009076 -- 139,732,843(+) TGTGT(A/G)TATAA intron-variant
rs1000042714 -- 139,726,017(+) AGGAC(C/G)CACCT intron-variant
rs1000047503 -- 139,687,090(+) ATGAA(A/G)TATTT intron-variant
rs1000060040 -- 139,648,374(+) CAGAT(G/T)ATCAC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for HIPK2 Gene

Variant ID Type Subtype PubMed ID
dgv6641n100 CNV gain 25217958
esv2663283 CNV deletion 23128226
esv2735212 CNV deletion 23290073
esv3419302 CNV insertion 20981092
esv3430553 CNV duplication 20981092
esv3615217 CNV loss 21293372
nsv1075062 CNV deletion 25765185
nsv1112943 CNV deletion 24896259
nsv1133671 CNV deletion 24896259
nsv464732 CNV gain 19166990
nsv473319 CNV novel sequence insertion 20440878
nsv473897 CNV novel sequence insertion 20440878
nsv473970 CNV novel sequence insertion 20440878
nsv475190 CNV novel sequence insertion 20440878
nsv475218 CNV novel sequence insertion 20440878
nsv478945 CNV novel sequence insertion 20440878
nsv479268 CNV novel sequence insertion 20440878
nsv479672 CNV novel sequence insertion 20440878
nsv480101 CNV novel sequence insertion 20440878
nsv480124 CNV novel sequence insertion 20440878
nsv480888 CNV novel sequence insertion 20440878
nsv480895 CNV novel sequence insertion 20440878
nsv481066 CNV novel sequence insertion 20440878
nsv481349 CNV novel sequence insertion 20440878
nsv608472 CNV gain 21841781
nsv824316 CNV gain 20364138
nsv824317 CNV loss 20364138

Variation tolerance for HIPK2 Gene

Gene Damage Index Score: 2.04; 37.42% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for HIPK2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK2 Gene

Disorders for HIPK2 Gene

MalaCards: The human disease database

(2) MalaCards diseases for HIPK2 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
hypoxia
pilocytic astrocytoma
  • grade i astrocytic tumor
- elite association - COSMIC cancer census association via MalaCards
Search HIPK2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for HIPK2

Genetic Association Database (GAD)
HIPK2
Human Genome Epidemiology (HuGE) Navigator
HIPK2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
HIPK2
genes like me logo Genes that share disorders with HIPK2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HIPK2 Gene

Publications for HIPK2 Gene

  1. How cells switch HIPK2 on and off. (PMID: 18974774) Sombroek D. … Hofmann T.G. (Cell Death Differ. 2009) 3 4 22 64
  2. Transcriptional regulation of hypoxia-inducible factor 1alpha by HIPK2 suggests a novel mechanism to restrain tumor growth. (PMID: 19046997) Nardinocchi L. … D'Orazi G. (Biochim. Biophys. Acta 2009) 3 4 22 64
  3. PML tumor suppressor is regulated by HIPK2-mediated phosphorylation in response to DNA damage. (PMID: 19015637) Gresko E. … Schmitz M.L. (Oncogene 2009) 3 4 22 64
  4. The human protein kinase HIPK2 phosphorylates and downregulates the methyl-binding transcription factor ZBTB4. (PMID: 19448668) Yamada D. … Defossez P.A. (Oncogene 2009) 3 4 22 64
  5. Targeting hypoxia in cancer cells by restoring homeodomain interacting protein-kinase 2 and p53 activity and suppressing HIF- 1alpha. (PMID: 19714248) Nardinocchi L. … D'Orazi G. (PLoS ONE 2009) 3 4 22 64

Products for HIPK2 Gene

  • Cloud-Clone Corp. Antibodies for HIPK2
  • Cloud-Clone Corp. Proteins for HIPK2
  • Cloud-Clone Corp Assay Kits for HIPK2
  • Addgene plasmids for HIPK2

Sources for HIPK2 Gene

Content
Loading form....