Free for academic non-profit institutions. Other users need a Commercial license

Aliases for HIPK1 Gene

Aliases for HIPK1 Gene

  • Homeodomain Interacting Protein Kinase 1 2 3 5
  • Nuclear Body-Associated Kinase 2 3 4
  • EC 2.7.11.1 4 61
  • Nbak2 3 4
  • Myak 3 4
  • Homeodomain Interacting Protein Kinase 1-Like Protein 3
  • Homeodomain-Interacting Protein Kinase 1 3
  • Nuclear Body Associated Kinase 2b 3
  • KIAA0630 4

External Ids for HIPK1 Gene

Previous GeneCards Identifiers for HIPK1 Gene

  • GC01P113572
  • GC01P113770
  • GC01P114184
  • GC01P114203
  • GC01P114273
  • GC01P114471
  • GC01P112330

Summaries for HIPK1 Gene

Entrez Gene Summary for HIPK1 Gene

  • The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]

GeneCards Summary for HIPK1 Gene

HIPK1 (Homeodomain Interacting Protein Kinase 1) is a Protein Coding gene. Among its related pathways are Regulation of TP53 Activity and Gene Expression. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.

UniProtKB/Swiss-Prot for HIPK1 Gene

  • Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.

Gene Wiki entry for HIPK1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK1 Gene

Genomics for HIPK1 Gene

Regulatory Elements for HIPK1 Gene

Enhancers for HIPK1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G113857 1.1 Ensembl ENCODE 16 -69.3 -69338 4.7 HDAC1 TBL1XR1 NFRKB CHAMP1 GATA2 ZNF207 RCOR1 FOS RELB IKZF2 HIPK1 DCLRE1B AP4B1 BCL2L15 HIPK1-AS1 PTPN22 OLFML3 PHTF1 GC01M113841
GH01G113869 1.3 Ensembl ENCODE 11 -56.0 -56014 7.6 HDGF PKNOX1 ATF1 YBX1 YY1 ZNF121 ZNF766 GATA2 CBX5 ZNF143 AP4B1 PHTF1 RSBN1 DCLRE1B ENSG00000231128 HIPK1 HIPK1-AS1 PTPN22 OLFML3 AP4B1-AS1
GH01G113804 1.2 Ensembl ENCODE 10.6 -124.2 -124218 1.3 HDGF PKNOX1 FOXA2 ATF1 ARNT SIN3A DMAP1 FEZF1 ZNF48 TCF12 PHTF1 AP4B1 DCLRE1B HIPK1-AS1 HIPK1 ENSG00000231128 PIR59903
GH01G113878 1 Ensembl ENCODE 11.2 -48.8 -48757 3.2 HDGF TBP ASH2L PAX8 ZBTB40 ZNF664 NFYB RELB IKZF2 MTA2 AP4B1 PHTF1 DCLRE1B HIPK1 HIPK1-AS1 OLFML3 MAGI3 PTPN22 BCL2L15
GH01G113779 1.8 FANTOM5 Ensembl ENCODE dbSUPER 4.7 -146.0 -146005 6.4 HDGF PKNOX1 ATF1 FEZF1 TCF12 ELK1 ZNF263 JUNB TBX21 KAT8 RSBN1 PHTF1 ENSG00000231128 AP4B1 MAGI3 PTPN22 HIPK1 PIR59903
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around HIPK1 on UCSC Golden Path with GeneCards custom track

Promoters for HIPK1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000011636 708 3401 MLX CREB3L1 ZFP64 FEZF1 DMAP1 YY1 ZNF143 ZNF263 SP3 NFYC

Genomic Location for HIPK1 Gene

Chromosome:
1
Start:
113,929,192 bp from pter
End:
113,977,869 bp from pter
Size:
48,678 bases
Orientation:
Plus strand

Genomic View for HIPK1 Gene

Genes around HIPK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HIPK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HIPK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for HIPK1 Gene

Proteins for HIPK1 Gene

  • Protein details for HIPK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q86Z02-HIPK1_HUMAN
    Recommended name:
    Homeodomain-interacting protein kinase 1
    Protein Accession:
    Q86Z02
    Secondary Accessions:
    • A6NJ34
    • O75125
    • Q5SQL2
    • Q5SQL4
    • Q5SQL5
    • Q8IYD7
    • Q8NDN5
    • Q8NEB6
    • Q8TBZ1

    Protein attributes for HIPK1 Gene

    Size:
    1210 amino acids
    Molecular mass:
    130843 Da
    Quaternary structure:
    • Interacts with Nkx1-2, Nkx2-5, MYB, PARK7, DAXX and p53/TP53. Part of a cytoplasmic complex made of HIPK1, DAB2IP and MAP3K5 in response to TNF. This complex formation promotes MAP3K5-JNK activation and subsequent apoptosis.

    Alternative splice isoforms for HIPK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for HIPK1 Gene

Selected DME Specific Peptides for HIPK1 Gene

Q86Z02:
  • HLLDFPHS
  • CGLKRKSEE
  • KSKEARKYIFN
  • SDTDEEE
  • LNYQSALY
  • EGDYQLVQHE
  • RVKVIDFGSAS
  • IRPILQQVATAL
  • EIVAIKILKNHPSYARQGQIEVSIL
  • NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
  • SILSRLS
  • VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
  • EYDQIRYISQTQGLP

Post-translational modifications for HIPK1 Gene

  • Autophosphorylated. Phosphorylated and activated by JNK1.
  • Degraded by PARK7 at the protein level.
  • Sumoylated. When conjugated it is directed to nuclear speckles. SENP1-mediated desumoylation is mediated by TNF in response to stress stimuli, triggering transient translocation from nucleus to cytoplasm.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for HIPK1 Gene

Gene Families for HIPK1 Gene

Protein Domains for HIPK1 Gene

Suggested Antigen Peptide Sequences for HIPK1 Gene

Graphical View of Domain Structure for InterPro Entry

Q86Z02

UniProtKB/Swiss-Prot:

HIPK1_HUMAN :
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Family:
  • Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
genes like me logo Genes that share domains with HIPK1: view

Function for HIPK1 Gene

Molecular function for HIPK1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.

Enzyme Numbers (IUBMB) for HIPK1 Gene

Gene Ontology (GO) - Molecular Function for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003677 DNA binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 12702766
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with HIPK1: view
genes like me logo Genes that share phenotypes with HIPK1: view

Animal Models for HIPK1 Gene

MGI Knock Outs for HIPK1:

Animal Model Products

  • Taconic Biosciences Mouse Models for HIPK1

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HIPK1 Gene

Localization for HIPK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HIPK1 Gene

Nucleus. Cytoplasm. Note=Predominantly nuclear. Translocates from nucleus to cytoplasm in response to stress stimuli via SENP1-mediated desumoylation.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HIPK1 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 5
mitochondrion 1

Gene Ontology (GO) - Cellular Components for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 15701637
GO:0005654 nucleoplasm IDA,TAS --
GO:0005737 cytoplasm IEA,IDA 15701637
GO:0005813 centrosome IDA --
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with HIPK1: view

Pathways & Interactions for HIPK1 Gene

genes like me logo Genes that share pathways with HIPK1: view

Pathways by source for HIPK1 Gene

Gene Ontology (GO) - Biological Process for HIPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001654 eye development ISS 20579985
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
GO:0006468 protein phosphorylation IEA --
GO:0007224 smoothened signaling pathway IEA --
genes like me logo Genes that share ontologies with HIPK1: view

No data available for SIGNOR curated interactions for HIPK1 Gene

Drugs & Compounds for HIPK1 Gene

(7) Drugs for HIPK1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
MYRISTIC ACID Experimental Pharma 0
Palmitic Acid Experimental Pharma Full agonist, Agonist 22
Stearic acid Experimental Pharma 0
Tridecanoic acid Experimental Pharma 0

(5) Additional Compounds for HIPK1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Arachidic acid
  • Arachate
  • Arachic acid
  • Arachidate
  • Arachidic acid
  • Eicosanoate
506-30-9
Heptadecanoic acid
  • Heptadecanoate
  • Heptadecanoic acid
  • Margarate
  • Margaric acid
  • Margarinate
506-12-7
Heptadecanoyl CoA
  • Heptadecanoate
  • Heptadecanoic acid
  • Heptadecanoic acid coa
  • Heptadecanoyl coenzyme A
  • Heptadecanoyl-coA
3546-17-6
Pentadecanoic acid
  • N-Pentadecanoate
  • N-Pentadecanoic acid
  • N-Pentadecylate
  • N-Pentadecylic acid
  • Pentadecanoate
1002-84-2
genes like me logo Genes that share compounds with HIPK1: view

Transcripts for HIPK1 Gene

Unigene Clusters for HIPK1 Gene

Homeodomain interacting protein kinase 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for HIPK1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^ 17a · 17b ^ 18 ^ 19 ^ 20 ^
SP1: - - - - - -
SP2: - -
SP3: - - - - - - -
SP4:
SP5:
SP6:
SP7:
SP8: - -

ExUns: 21a · 21b ^ 22a · 22b
SP1: -
SP2: -
SP3:
SP4: -
SP5: -
SP6:
SP7:
SP8:

Relevant External Links for HIPK1 Gene

GeneLoc Exon Structure for
HIPK1
ECgene alternative splicing isoforms for
HIPK1

Expression for HIPK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for HIPK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for HIPK1 Gene

This gene is overexpressed in Pancreas (66.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK1 Gene



Protein tissue co-expression partners for HIPK1 Gene

NURSA nuclear receptor signaling pathways regulating expression of HIPK1 Gene:

HIPK1

SOURCE GeneReport for Unigene cluster for HIPK1 Gene:

Hs.532363

mRNA Expression by UniProt/SwissProt for HIPK1 Gene:

Q86Z02-HIPK1_HUMAN
Tissue specificity: Ubiquitously expressed with highest levels in skeletal muscle and heart. Overexpressed in breast cancer cell lines. Isoform 2 is highly expressed in testis.

Evidence on tissue expression from TISSUES for HIPK1 Gene

  • Nervous system(4.7)
genes like me logo Genes that share expression patterns with HIPK1: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK1 Gene

Orthologs for HIPK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for HIPK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia HIPK1 34 35
  • 99.75 (n)
dog
(Canis familiaris)
Mammalia HIPK1 34 35
  • 94.82 (n)
cow
(Bos Taurus)
Mammalia HIPK1 34 35
  • 94.1 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia HIPK1 35
  • 94 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Hipk1 34 16 35
  • 92.01 (n)
rat
(Rattus norvegicus)
Mammalia Hipk1 34
  • 91.49 (n)
oppossum
(Monodelphis domestica)
Mammalia HIPK1 35
  • 90 (a)
OneToOne
chicken
(Gallus gallus)
Aves HIPK1 34 35
  • 80.24 (n)
lizard
(Anolis carolinensis)
Reptilia HIPK1 35
  • 75 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia hipk1 34
  • 76.02 (n)
Str.1884 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.21248 34
zebrafish
(Danio rerio)
Actinopterygii HIPK1 (1 of 2) 35
  • 57 (a)
OneToMany
HIPK1 (2 of 2) 35
  • 51 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta hipk 35
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea hpk-1 35
  • 41 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YAK1 35
  • 23 (a)
OneToMany
Species where no ortholog for HIPK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for HIPK1 Gene

ENSEMBL:
Gene Tree for HIPK1 (if available)
TreeFam:
Gene Tree for HIPK1 (if available)

Paralogs for HIPK1 Gene

(12) SIMAP similar genes for HIPK1 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with HIPK1: view

Variants for HIPK1 Gene

Sequence variations from dbSNP and Humsavar for HIPK1 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000042630 -- 113,935,236(+) CATGT(A/G)TTCTC intron-variant
rs1000068284 -- 113,935,092(+) TATGT(C/T)ACAGG intron-variant
rs1000090081 -- 113,959,259(+) GTTTC(C/T)GATAG intron-variant
rs1000109384 -- 113,936,685(+) GTCTC(A/G)AACTC intron-variant
rs1000122783 -- 113,931,824(+) TTGTA(A/T)CTGGT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for HIPK1 Gene

Variant ID Type Subtype PubMed ID
esv23869 CNV loss 19812545
esv3539767 CNV deletion 23714750
esv3578118 CNV loss 25503493
esv3587240 CNV loss 21293372
esv3587251 CNV loss 21293372
esv3587252 CNV loss 21293372
esv3587253 CNV loss 21293372
nsv523196 CNV loss 19592680
nsv951401 CNV duplication 24416366

Variation tolerance for HIPK1 Gene

Residual Variation Intolerance Score: 2.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 9.22; 88.03% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for HIPK1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
HIPK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK1 Gene

Disorders for HIPK1 Gene

Relevant External Links for HIPK1

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
HIPK1

No disorders were found for HIPK1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK1 Gene

Publications for HIPK1 Gene

  1. Characterization of cells and gene-targeted mice deficient for the p53-binding kinase homeodomain-interacting protein kinase 1 (HIPK1). (PMID: 12702766) Kondo S. … Thukral S.K. (Proc. Natl. Acad. Sci. U.S.A. 2003) 3 4 22 64
  2. HIPK1 interacts with c-Myb and modulates its activity through phosphorylation. (PMID: 19646965) Matre V. … Gabrielsen O.S. (Biochem. Biophys. Res. Commun. 2009) 3 4 64
  3. DJ-1 interacts with HIPK1 and affects H2O2-induced cell death. (PMID: 16390825) Sekito A. … Ariga H. (Free Radic. Res. 2006) 3 4 64
  4. Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation. (PMID: 15701637) Li X. … Min W. (J. Biol. Chem. 2005) 3 4 64
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64

Products for HIPK1 Gene

  • Addgene plasmids for HIPK1

Sources for HIPK1 Gene

Content
Loading form....