Aliases for HIPK1 Gene
Aliases for HIPK1 Gene
External Ids for HIPK1 Gene
- HGNC: 19006
- Entrez Gene: 204851
- Ensembl: ENSG00000163349
- OMIM: 608003
- UniProtKB: Q86Z02
Previous GeneCards Identifiers for HIPK1 Gene
- GC01P113572
- GC01P113770
- GC01P114184
- GC01P114203
- GC01P114273
- GC01P114471
- GC01P112330
Summaries for HIPK1 Gene
-
The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]
GeneCards Summary for HIPK1 Gene
HIPK1 (Homeodomain Interacting Protein Kinase 1) is a Protein Coding gene. Among its related pathways are Regulation of TP53 Activity and Cardiac conduction. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.
UniProtKB/Swiss-Prot for HIPK1 Gene
-
Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HIPK1 Gene
Genomics for HIPK1 Gene
Regulatory Elements for HIPK1 Gene
Enhancers for HIPK1 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around HIPK1 on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the HIPK1 gene promoter:
Regulatory Element Products
Genomic Location for HIPK1 Gene
- Chromosome:
- 1
- Start:
- 113,929,192 bp from pter
- End:
- 113,977,869 bp from pter
- Size:
- 48,678 bases
- Orientation:
- Plus strand
Genomic View for HIPK1 Gene
Genes around HIPK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 1p13.2 by Ensembl
- 1p13.2 by Entrez Gene
- 1p13.2 by HGNC
HIPK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for HIPK1 Gene
Proteins for HIPK1 Gene
-
Protein details for HIPK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q86Z02-HIPK1_HUMAN
- Recommended name:
- Homeodomain-interacting protein kinase 1
- Protein Accession:
- Q86Z02
- A6NJ34
- O75125
- Q5SQL2
- Q5SQL4
- Q5SQL5
- Q8IYD7
- Q8NDN5
- Q8NEB6
- Q8TBZ1
Protein attributes for HIPK1 Gene
- Size:
- 1210 amino acids
- Molecular mass:
- 130843 Da
- Quaternary structure:
-
- Interacts with Nkx1-2, Nkx2-5, MYB, PARK7, DAXX and p53/TP53. Part of a cytoplasmic complex made of HIPK1, DAB2IP and MAP3K5 in response to TNF. This complex formation promotes MAP3K5-JNK activation and subsequent apoptosis.
Protein Expression for HIPK1 Gene
Selected DME Specific Peptides for HIPK1 Gene
- Q86Z02:
-
- HLLDFPHS
- CGLKRKSEE
- KSKEARKYIFN
- SDTDEEE
- LNYQSALY
- EGDYQLVQHE
- RVKVIDFGSAS
- IRPILQQVATAL
- EIVAIKILKNHPSYARQGQIEVSIL
- NHTCLVFEMLEQNLYDFLKQNKFSPLPLK
- SILSRLS
- VCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAE
- EYDQIRYISQTQGLP
Post-translational modifications for HIPK1 Gene
- Autophosphorylated. Phosphorylated and activated by JNK1.
- Degraded by PARK7 at the protein level.
- Sumoylated. When conjugated it is directed to nuclear speckles. SENP1-mediated desumoylation is mediated by TNF in response to stress stimuli, triggering transient translocation from nucleus to cytoplasm.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for HIPK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for HIPK1 (HIPK1)
- Novus Biologicals Antibodies for HIPK1
-
Cloud-Clone Corp. Antibodies for HIPK1
- Invitrogen Antibodies for HIPK1
- antibodies-online Antibodies for HIPK1: See all 56
- GeneTex HIPK1 antibody for HIPK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for HIPK1
Protein Products
- EMD Millipore Purified and/or Recombinant HIPK1 Protein
-
OriGene Purified Proteins for HIPK1
- Search Origene for MassSpec and Protein Over-expression Lysates for HIPK1
- Origene Custom Protein Services for HIPK1
-
Cloud-Clone Corp. Proteins for HIPK1
- antibodies-online Proteins for HIPK1: See all 4
- Search antibodies-online for peptides
- Search GeneTex for Proteins for HIPK1
Assay Products
Domains & Families for HIPK1 Gene
Gene Families for HIPK1 Gene
Protein Domains for HIPK1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for HIPK1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q86Z02UniProtKB/Swiss-Prot:
HIPK1_HUMAN :- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. HIPK subfamily.
Function for HIPK1 Gene
Molecular function for HIPK1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase involved in transcription regulation and TNF-mediated cellular apoptosis. Plays a role as a corepressor for homeodomain transcription factors. Phosphorylates DAXX and MYB. Phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. Inactivates MYB transcription factor activity by phosphorylation. Prevents MAP3K5-JNK activation in the absence of TNF. TNF triggers its translocation to the cytoplasm in response to stress stimuli, thus activating nuclear MAP3K5-JNK by derepression and promoting apoptosis. May be involved in anti-oxidative stress responses. Involved in the regulation of eye size, lens formation and retinal lamination during late embryogenesis. Promotes angiogenesis and to be involved in erythroid differentiation. May be involved in malignant squamous cell tumor formation.
Enzyme Numbers (IUBMB) for HIPK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003677 | DNA binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | IEA | -- |
| GO:0005515 | protein binding | IPI | 12702766 |
| GO:0005524 | ATP binding | IEA | -- |
Phenotypes for HIPK1 Gene
- MGI mutant phenotypes for HIPK1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for HIPK1:
-
- shRNA abundance <= 50%
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased viability in esophageal squamous lineage
- Decreased shRNA abundance (Z-score < -2)
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased substrate adherent cell growth
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Decreased viability
- Condensed cis-Golgi
- Decreased viability after gemcitabine stimulation
- Increased senescence-associated beta-galactosidase protein expression after pRB stimulation
- Synthetic lethal with gemcitabine
- Decreased CYP1A1 activity after TCDD stimulation
Animal Model Products
-
Taconic Biosciences Mouse Models for HIPK1
-
ViGene Biosciences lentiviral particle packaged cDNA for HIPK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK1 gene
- Search ViGene Biosciences for HIPK1
CRISPR Products
-
OriGene CRISPR knockouts for HIPK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for HIPK1
- GenScript: Design CRISPR guide RNA sequences for HIPK1
miRNA for HIPK1 Gene
- miRTarBase miRNAs that target HIPK1
-
- hsa-mir-590-3p (MIRT016192)
- hsa-mir-26b-5p (MIRT029031)
- hsa-mir-19b-3p (MIRT031114)
- hsa-mir-877-3p (MIRT036950)
- hsa-mir-615-3p (MIRT040363)
- hsa-mir-484 (MIRT041890)
- hsa-mir-92a-3p (MIRT049450)
- hsa-let-7e-5p (MIRT051518)
- hsa-let-7b-5p (MIRT052071)
- hsa-mir-1260b (MIRT052695)
- hsa-mir-548e-5p (MIRT111168)
- hsa-mir-524-5p (MIRT179720)
- hsa-mir-520d-5p (MIRT179721)
- hsa-mir-548ao-5p (MIRT265336)
- hsa-mir-5585-5p (MIRT265337)
- hsa-mir-548ax (MIRT265338)
- hsa-mir-5689 (MIRT332140)
- hsa-mir-766-5p (MIRT332148)
- hsa-mir-1255a (MIRT409617)
- hsa-mir-1255b-5p (MIRT409618)
- hsa-mir-5004-5p (MIRT409619)
- hsa-mir-7154-3p (MIRT409620)
- hsa-mir-7847-3p (MIRT409621)
- hsa-mir-6744-5p (MIRT560453)
- hsa-mir-6894-5p (MIRT560454)
- hsa-mir-765 (MIRT560455)
- hsa-mir-6080 (MIRT560456)
- hsa-mir-6849-5p (MIRT560457)
- hsa-mir-3681-5p (MIRT560458)
- hsa-mir-573 (MIRT560459)
- hsa-mir-3616-5p (MIRT560460)
- hsa-mir-3163 (MIRT560461)
- hsa-mir-4646-3p (MIRT645934)
- hsa-mir-4433b-5p (MIRT645935)
- hsa-mir-3655 (MIRT645936)
- hsa-mir-3065-5p (MIRT645937)
- hsa-mir-4762-5p (MIRT645938)
- hsa-mir-3529-3p (MIRT645939)
- hsa-mir-7-2-3p (MIRT645940)
- hsa-mir-7-1-3p (MIRT645941)
miRNA Products
- Search ViGene Biosciences for HIPK1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HIPK1
- Browse OriGene Inhibitory RNA Products For HIPK1
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HIPK1
Cell Line Products
-
Horizon Cell Lines for HIPK1
-
ViGene Biosciences adenoviral particle packaged cDNA for HIPK1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for HIPK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK1 gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HIPK1 Gene
Localization for HIPK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HIPK1 Gene
- Nucleus. Cytoplasm. Note=Predominantly nuclear. Translocates from nucleus to cytoplasm in response to stress stimuli via SENP1-mediated desumoylation.
| Compartment | Confidence |
|---|---|
| cytoskeleton | 5 |
| nucleus | 5 |
| cytosol | 5 |
| mitochondrion | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA,IDA | 15701637 |
| GO:0005654 | nucleoplasm | IDA,TAS | -- |
| GO:0005737 | cytoplasm | IEA,IDA | 15701637 |
| GO:0005813 | centrosome | IDA | -- |
| GO:0005829 | cytosol | IDA | -- |
Pathways & Interactions for HIPK1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cardiac conduction | ||
| 2 | Regulation of TP53 Activity | ||
| 3 | Gene Expression |
.48
|
|
| 4 | BMAL1-CLOCK,NPAS2 activates circadian gene expression | ||
Pathways by source for HIPK1 Gene
9 Reactome pathways for HIPK1 Gene
Interacting Proteins for HIPK1 Gene
Selected Interacting proteins:
ENSP00000358571
Q86Z02-HIPK1_HUMAN
for HIPK1 Gene via
STRING
MINT
IID
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001654 | eye development | ISS | 20579985 |
| GO:0006351 | transcription, DNA-templated | IEA | -- |
| GO:0006355 | regulation of transcription, DNA-templated | IEA | -- |
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0007224 | smoothened signaling pathway | IEA | -- |
No data available for SIGNOR curated interactions for HIPK1 Gene
Drugs & Compounds for HIPK1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| Arachidic acid |
|
506-30-9 |
|
|||
| Heptadecanoic acid |
|
506-12-7 |
|
|||
| Heptadecanoyl CoA |
|
3546-17-6 |
|
|||
| Pentadecanoic acid |
|
1002-84-2 |
|
Transcripts for HIPK1 Gene
mRNA/cDNA for HIPK1 Gene
- (13) REFSEQ mRNAs :
- (10) Additional mRNA sequences :
- (288) Selected AceView cDNA sequences:
- (11) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for HIPK1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for HIPK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for HIPK1
- GenScript: Design CRISPR guide RNA sequences for HIPK1
miRNA Products
- Search ViGene Biosciences for HIPK1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HIPK1
- Browse OriGene Inhibitory RNA Products For HIPK1
-
ViGene Biosciences ready-to-package AAV shRNAs for HIPK1 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HIPK1
Flow Cytometry Products
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6a | · | 6b | · | 6c | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 | ^ | 15 | ^ | 16a | · | 16b | ^ | 17a | · | 17b | ^ | 18 | ^ | 19 | ^ | 20 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - |
| ExUns: | 21a | · | 21b | ^ | 22a | · | 22b |
|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||
| SP2: | - | ||||||
| SP3: | |||||||
| SP4: | - | ||||||
| SP5: | - | ||||||
| SP6: | |||||||
| SP7: | |||||||
| SP8: |
Expression for HIPK1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Bone (Muscoskeletal System)
This gene is overexpressed in Pancreas (66.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for HIPK1 Gene
NURSA nuclear receptor signaling pathways regulating expression of HIPK1 Gene:
HIPK1SOURCE GeneReport for Unigene cluster for HIPK1 Gene:
Hs.532363mRNA Expression by UniProt/SwissProt for HIPK1 Gene:
Q86Z02-HIPK1_HUMAN
Tissue specificity:
Ubiquitously expressed with highest levels in skeletal muscle and heart. Overexpressed in breast cancer cell lines. Isoform 2 is highly expressed in testis.
Evidence on tissue expression from TISSUES for HIPK1 Gene
- Nervous system(4.7)
Primer Products
-
OriGene qPCR primer pairs and template standards for HIPK1
-
OriGene qPCR primer pairs for HIPK1
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HIPK1 Gene
Orthologs for HIPK1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | HIPK1 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | HIPK1 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | HIPK1 34 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | HIPK1 35 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Hipk1 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Hipk1 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | HIPK1 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | HIPK1 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | HIPK1 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | hipk1 34 |
|
||
| Str.1884 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.21248 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | HIPK1 (1 of 2) 35 |
|
OneToMany | |
| HIPK1 (2 of 2) 35 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | hipk 35 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | hpk-1 35 |
|
OneToMany | |
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YAK1 35 |
|
OneToMany |
- Species where no ortholog for HIPK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for HIPK1 Gene
Paralogs for HIPK1 Gene
(12) SIMAP similar genes for HIPK1 Gene using alignment to 6 proteins:
Variants for HIPK1 Gene
| SNP ID | Clin | Chr 01 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000042630 | -- | 113,935,236(+) | CATGT(A/G)TTCTC | intron-variant | |
| rs1000068284 | -- | 113,935,092(+) | TATGT(C/T)ACAGG | intron-variant | |
| rs1000090081 | -- | 113,959,259(+) | GTTTC(C/T)GATAG | intron-variant | |
| rs1000109384 | -- | 113,936,685(+) | GTCTC(A/G)AACTC | intron-variant | |
| rs1000122783 | -- | 113,931,824(+) | TTGTA(A/T)CTGGT | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv23869 | CNV | loss | 19812545 |
| esv3539767 | CNV | deletion | 23714750 |
| esv3578118 | CNV | loss | 25503493 |
| esv3587240 | CNV | loss | 21293372 |
| esv3587251 | CNV | loss | 21293372 |
| esv3587252 | CNV | loss | 21293372 |
| esv3587253 | CNV | loss | 21293372 |
| nsv523196 | CNV | loss | 19592680 |
| nsv951401 | CNV | duplication | 24416366 |
Residual Variation Intolerance Score:
2.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
9.22;
88.03% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for HIPK1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- HIPK1
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HIPK1 Gene
Disorders for HIPK1 Gene
Relevant External Links for HIPK1
- Atlas of Genetics and Cytogenetics in Oncology and Haematology:
- HIPK1
No disorders were found for HIPK1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for HIPK1 Gene
Publications for HIPK1 Gene
- Characterization of cells and gene-targeted mice deficient for the p53-binding kinase homeodomain-interacting protein kinase 1 (HIPK1). (PMID: 12702766) Kondo S. … Thukral S.K. (Proc. Natl. Acad. Sci. U.S.A. 2003) 3 4 22 64
- HIPK1 interacts with c-Myb and modulates its activity through phosphorylation. (PMID: 19646965) Matre V. … Gabrielsen O.S. (Biochem. Biophys. Res. Commun. 2009) 3 4 64
- DJ-1 interacts with HIPK1 and affects H2O2-induced cell death. (PMID: 16390825) Sekito A. … Ariga H. (Free Radic. Res. 2006) 3 4 64
- Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation. (PMID: 15701637) Li X. … Min W. (J. Biol. Chem. 2005) 3 4 64
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
Products for HIPK1 Gene
- R&D Systems Antibodies for HIPK1 (HIPK1)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for HIPK1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HIPK1
- Search Origene for MassSpec and Protein Over-expression Lysates for HIPK1
- Origene Custom Protein Services for HIPK1
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HIPK1
- Browse OriGene Inhibitory RNA Products For HIPK1
- OriGene qPCR primer pairs and template standards for HIPK1
- OriGene qPCR primer pairs for HIPK1
- OriGene CRISPR knockouts for HIPK1
- OriGene ORF clones in human for HIPK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HIPK1
- GenScript: Next-day shipping cDNA ORF clone for HIPK1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for HIPK1
- GenScript Custom Assay Services for HIPK1
- GenScript Custom overexpressing Cell Line Services for HIPK1
- GenScript: Design CRISPR guide RNA sequences for HIPK1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for HIPK1
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for HIPK1
- Novus Biologicals proteins and lysates for HIPK1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Cloud-Clone Corp. Antibodies for HIPK1
- Cloud-Clone Corp. Proteins for HIPK1
- Browse Assay Kits at Cloud-Clone Corp.
- Taconic Biosciences Mouse Models for HIPK1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Addgene plasmids for HIPK1
- antibodies-online Antibodies for HIPK1: See all 56
- Search antibodies-online for kits
- antibodies-online Proteins for HIPK1: See all 4
- Search antibodies-online for peptides
- GeneTex HIPK1 antibody for HIPK1
- Search GeneTex for Proteins for HIPK1
- ViGene Biosciences adenoviral particle packaged cDNA for HIPK1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for HIPK1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for HIPK1 gene
- Search ViGene Biosciences for HIPK1
- Santa Cruz Biotechnology (SCBT) Antibodies for HIPK1
- Search Santa Cruz Biotechnology (SCBT) for HIPK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for HIPK1
- Horizon Cell Lines for HIPK1
- Cyagen custom Knockout/knockin (KOKI) mouse models for HIPK1
- VectorBuilder custom plasmid, inducible vectors for HIPK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for HIPK1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for HIPK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer