Aliases for HDAC1 Gene
Aliases for HDAC1 Gene
External Ids for HDAC1 Gene
- HGNC: 4852
- Entrez Gene: 3065
- Ensembl: ENSG00000116478
- OMIM: 601241
- UniProtKB: Q13547
Previous HGNC Symbols for HDAC1 Gene
- RPD3L1
Previous GeneCards Identifiers for HDAC1 Gene
- GC01P032525
- GC01P031697
- GC01P032184
- GC01P032426
- GC01P032757
- GC01P030873
Summaries for HDAC1 Gene
-
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]
GeneCards Summary for HDAC1 Gene
HDAC1 (Histone Deacetylase 1) is a Protein Coding gene. Diseases associated with HDAC1 include Atrichia With Papular Lesions and Retinoblastoma. Among its related pathways are PEDF Induced Signaling and Signaling by NOTCH1. Gene Ontology (GO) annotations related to this gene include DNA binding transcription factor activity and transcription factor binding. An important paralog of this gene is HDAC2.
UniProtKB/Swiss-Prot for HDAC1 Gene
-
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
-
Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.
Additional gene information for HDAC1 Gene
- Monarch Initiative
- Search for HDAC1 at DataMed
- Search for HDAC1 at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HDAC1 Gene
Genomics for HDAC1 Gene
GeneHancer (GH) Regulatory Elements for HDAC1 Gene
- Top Transcription factor binding sites by QIAGEN in the HDAC1 gene promoter:
Regulatory Element Products
Genomic Locations for HDAC1 Gene
- chr1:32,292,086-32,333,635
- (GRCh38/hg38)
- Size:
- 41,550 bases
- Orientation:
- Plus strand
- chr1:32,757,687-32,799,236
- (GRCh37/hg19)
Genomic View for HDAC1 Gene
- Cytogenetic band:
-
- 1p35.2 by Ensembl
- 1p35.2-p35.1 by Entrez Gene
- 1p35.2-p35.1 by HGNC


RefSeq DNA sequence for HDAC1 Gene
Proteins for HDAC1 Gene
-
Protein details for HDAC1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13547-HDAC1_HUMAN
- Recommended name:
- Histone deacetylase 1
- Protein Accession:
- Q13547
- Q92534
Protein attributes for HDAC1 Gene
- Size:
- 482 amino acids
- Molecular mass:
- 55103 Da
- Quaternary structure:
-
- Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Found in a trimeric complex with APBB1 and TSHZ3; the interaction between HDAC1 and APBB1 is mediated by TSHZ3. Component of a RCOR/GFI/KDM1A/HDAC complex. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Associates with the 9-1-1 complex; interacts with HUS1. Found in a complex with DNMT3A and HDAC7. Interacts with the non-histone region of H2AFY. Interacts with TRIM28; the interaction recruits HDAC1 to E2F1 and inhibits its acetylation. Interacts with SP1; the interaction deacetylates SP1 and regulates its transcriptional activity. Interacts with SP3; the interaction deacetylates SP3 and regulates its transcriptional activity. In vitro, C(18) ceramides increase this interaction and the subsequent SP3 deacetylation and SP3-mediated repression of the TERT promoter. Interacts with TSHZ3 (via N-terminus); the interaction is direct. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with C10orf90/FATS (via its N-terminal); the interaction prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. Interacts with CDKN1A/p21. Interacts with CDK5 complexed to CDK5R1 (p25). Interacts directly with GFI1 and GFI1B. Interacts with NR1D2 (via C-terminus). Interacts with TSC22D3 isoform 1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity. Interacts with BAZ2A/TIP5, BANP, BCL6, BCOR, BHLHE40/DEC1, BRMS1, BRMS1L, CBFA2T3, CHFR, CIART, CRY1, DAXX, DDIT3/CHOP, DDX5, DNMT1, E4F1, EP300, HCFC1, HDAC9, INSM1, NFE4, NR4A2/NURR1, MIER1, KDM4A, KDM5B, KLF1, MINT, NRIP1, PCAF, PHB2, PRDM6, PRDM16, RB1, RERE, SAMSN1, SAP30L, SETDB1, SMAD3, SMARCA4/BRG1, SMYD2, SUV39H1, TGIF, TGIF2, TRAF6, UHRF1, UHRF2, ZMYND15, ZNF431 and ZNF541. Interacts with KDM5A (By similarity). Interacts with DNTTIP1 (PubMed:25653165). Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and ELMSAN1; this complex assembles into a tetramer that contains four copies of each protein chain (PubMed:25653165). Interacts with CCAR2 (PubMed:21030595). Interacts with PPHLN1 (PubMed:17963697). Found in a complex with YY1, SIN3A and GON4L (By similarity). Interacts with CHD4 (PubMed:27616479). Found in a complex composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1. Interacts with SIN3A (By similarity).
Protein Expression for HDAC1 Gene
Selected DME Specific Peptides for HDAC1 Gene
- Q13547:
-
- AVVLQCG
- RLFENLRMLPHAPGVQ
- HHGDGVEEAFY
- DIGAGKGK
- HPMKPHR
- DIDIHHGDGV
- LNYGLYR
- GGLHHAKK
- FVKSFNLPM
- IRPDNMSEY
- KVCYYYDGD
- DRLGCFNL
- LRDGIDD
- RCWTYET
- NELPYNDYFEYFGPDFKLHISPSNMTNQNT
- PDKRISI
- DGIDDESY
- KGHAKCVE
- EYLEKIK
- LELLKYH
- SDKRIAC
- GGGGYTIRNV
- DRVMTVSFH
- NFKKAKRVKTE
- FNVGEDCP
- VSFHKYG
- RVLYIDID
- AVKLNKQ
- GEYFPGTG
Post-translational modifications for HDAC1 Gene
- Phosphorylation on Ser-421 and Ser-423 promotes enzymatic activity and interactions with NuRD and SIN3 complexes. Phosphorylated by CDK5.
- Sumoylated on Lys-444 and Lys-476; which promotes enzymatic activity. Desumoylated by SENP1.
- Ubiquitinated by CHFR, leading to its degradation by the proteasome. Ubiquitinated by KCTD11, leading to proteasomal degradation.
- Ubiquitination at posLast=1010, isoforms=66, posLast=7474, posLast=126126, isoforms=279, and isoforms=361
Other Protein References for HDAC1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for HDAC1 (HDAC1)
-
Custom Antibody ServicesOriGene Antibodies for HDAC1
- CF502193
- TA502193
- CF502143
- TA502143
- CF502142
- TA502142
- CF502028
- TA502028
- CF501999
- TA501999
- TA353865
- TA349072
- TA348969
- TA347135
- TA347134
- TA336336
- TA326790
- TA325508
- TA325507
- TA325506
- TA325167
- TA324678
- TA324609
- TA324515
- TA322693
- TA322692
- TA322691
- TA319251
- TA312925
- AP32235PU-N
- AP32221PU-N
- AP23098PU-N
- AP21036PU-N
- AP20947PU-N
- AP11121PU-N
- AP07556PU-N
- AP06155PU-N
- AP00270PU-N
- AM31797PU-N
- AM31796PU-N
- AM31795PU-N
- AM31794PU-N
- AM20512PU-N
- Novus Biologicals Antibodies for HDAC1
-
Abcam antibodies for HDAC1
-
Cloud-Clone Corp. Antibodies for HDAC1
- Invitrogen Antibodies for HDAC1
- antibodies-online: Search results for 409 available HDAC1 Antibodies ranked by validation data
- Compare Top HDAC1 Antibodies
-
Recommended
- 1 IHC Antibody (anti-human)
- 1 IF/ICC Antibody (anti-human)
- 1 IF Antibody (anti-human)
- 7 IP Antibodies (anti-human)
- 8 IHC (p) Antibodies (anti-human)
- 354 WB Antibodies (anti-human)
- 1 IHC Antibody (anti-rat)
- 2 IP Antibodies (anti-rat)
- 4 IHC (p) Antibodies (anti-rat)
- 148 WB Antibodies (anti-rat)
- 1 IHC Antibody (anti-mouse)
- 2 IP Antibodies (anti-mouse)
- 5 IHC (p) Antibodies (anti-mouse)
- 174 WB Antibodies (anti-mouse)
- GeneTex HDAC1 antibody for HDAC1
-
Custom Antibody ServicesProSci Antibodies for HDAC1
-
Santa Cruz Biotechnology (SCBT) Antibodies for HDAC1
- Sino Biological Antibodies for HDAC1
Protein Products
-
OriGene Purified Proteins for HDAC1
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC1
- Origene Custom Protein Services for HDAC1
-
Cloud-Clone Corp. Proteins for HDAC1
- Search GeneTex for Proteins for HDAC1
-
Abcam proteins for HDAC1
Assay Products
-
Cloud-Clone Corp. Assay Kits for HDAC1
Domains & Families for HDAC1 Gene
Gene Families for HDAC1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for HDAC1 Gene
Suggested Antigen Peptide Sequences for HDAC1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q13547- Family:
-
- Belongs to the histone deacetylase family. HD type 1 subfamily.
Function for HDAC1 Gene
Molecular function for HDAC1 Gene
- GENATLAS Biochemistry:
- histone deacetyltransferase 1,modulator of chromatin structure,involved in repression of gene expression,through interaction with RB1,also downregulating MEF2 activity after being recruited by MITR
- UniProtKB/Swiss-Prot CatalyticActivity:
- Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
- UniProtKB/Swiss-Prot Function:
- Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
Enzyme Numbers (IUBMB) for HDAC1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000976 | transcription regulatory region sequence-specific DNA binding | ISS | -- |
GO:0000978 | contributes_to RNA polymerase II proximal promoter sequence-specific DNA binding | IDA,HDA | 16217013 |
GO:0000980 | contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding | IDA,HDA | 16217013 |
GO:0001046 | core promoter sequence-specific DNA binding | IDA | 23629966 |
GO:0001047 | core promoter binding | IDA | 18974119 |
Phenotypes for HDAC1 Gene
- MGI mutant phenotypes for HDAC1:
-
inferred from 9 alleles
- normal phenotype
- respiratory system phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- vision/eye phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- pigmentation phenotype
- liver/biliary system phenotype
- craniofacial phenotype
- no phenotypic analysis
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for HDAC1:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Increased gamma-H2AX phosphorylation
- Decreased ionizing radiation sensitivity
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Decreased NF-kappaB reporter expression
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with MLN4924 (a NAE inhibitor)
- Upregulation of Wnt/beta-catenin pathway after WNT3A stimulation
- Decreased HIV-1 infection
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
- Search ViGene Biosciences for HDAC1
CRISPR Products
-
OriGene CRISPR knockouts for HDAC1
- genomics-online: gRNA clones - Search results for available HDAC1 gene related products
- Applied Biological Materials CRISPR for HDAC1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC1
- GenScript: Design CRISPR guide RNA sequences for HDAC1
miRNA for HDAC1 Gene
- miRTarBase miRNAs that target HDAC1
miRNA Products
- Search ViGene Biosciences for HDAC1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
- genomics-online: shRNA clones - Search results for available HDAC1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
Clone Products
- Sino Biological Human cDNA Clone for HDAC1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HDAC1
- genomics-online: cdna clones - Search results for available HDAC1 gene related products
- orf clones - Search results for available HDAC1 gene related products
- Applied Biological Materials Clones for HDAC1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- Browse cDNA clones at Cloud-Clone Corp.
-
Cloud-Clone Corp. primers for HDAC1
Cell Line Products
-
Horizon Cell Lines for HDAC1
-
ViGene Biosciences adenoviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC1 Gene
Localization for HDAC1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HDAC1 Gene
- Nucleus.
- Nucleoplasm (4)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000118 | histone deacetylase complex | TAS | 12711221 |
GO:0000785 | chromatin | IEA,IDA | 16731528 |
GO:0000790 | nuclear chromatin | IDA | 22926524 |
GO:0005634 | nucleus | IDA,IEA | 10846170 |
GO:0005654 | nucleoplasm | TAS | -- |
Pathways & Interactions for HDAC1 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 |
.34
|
|
2 | Signaling by NOTCH1 | ||
3 | Notch signaling pathway (KEGG) |
.30
|
|
4 | Transcriptional activity of SMAD2/SMAD3-SMAD4 heterotrimer | ||
5 | p53 Signaling |
.44
.44
|
.44
|
Pathways by source for HDAC1 Gene
3 Sino Biological pathways for HDAC1 Gene
2 GeneTex pathways for HDAC1 Gene
1 Cell Signaling Technology pathway for HDAC1 Gene
31 BioSystems pathways for HDAC1 Gene
47 Reactome pathways for HDAC1 Gene
2 PharmGKB pathways for HDAC1 Gene
14 KEGG pathways for HDAC1 Gene
8 GeneGo (Thomson Reuters) pathways for HDAC1 Gene
2 R&D Systems pathways for HDAC1 Gene
17 Qiagen pathways for HDAC1 Gene
Interacting Proteins for HDAC1 Gene
SIGNOR curated interactions for HDAC1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000122 | negative regulation of transcription by RNA polymerase II | TAS | -- |
GO:0001975 | response to amphetamine | IEA | -- |
GO:0006325 | chromatin organization | TAS | 12711221 |
GO:0006338 | chromatin remodeling | IC | 16762839 |
GO:0006346 | methylation-dependent chromatin silencing | IGI | 23770133 |
Drugs & Compounds for HDAC1 Gene
(90) Drugs for HDAC1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, and Novoseek
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Romidepsin | Approved, Investigational | Pharma | Target, antagonist, inhibitor | Histone deacetylase (HDAC)inhibitors | 89 | |
Valproic Acid | Approved, Investigational | Pharma | inhibitor | HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors | 333 | |
Belinostat | Approved, Investigational | Pharma | Target, inhibitor | Histone deacetylase (HDAC)inhibitors | 42 | |
Panobinostat | Approved, Investigational | Pharma | Target, inhibitor, Inhibition | Histone deacetylase (HDAC)inhibitors | 136 | |
Vorinostat | Approved, Investigational | Pharma | Target, inhibitor | HDAC inhibitor, Histone deacetylase (HDAC)inhibitors | 254 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
---|
(3) Tocris Compounds for HDAC1 Gene
Compound | Action | Cas Number |
---|---|---|
Apicidin | Potent histone deacetylase inhibitor | 183506-66-3 |
PCI 34051 | Potent and selective HDAC8 inhibitor | 950762-95-5 |
Valproic acid, sodium salt | Histone deacetylase inhibitor | 1069-66-5 |
(43) ApexBio Compounds for HDAC1 Gene
Compound | Action | Cas Number |
---|---|---|
2-hexyl-4-Pentynoic Acid | Potent and robust HDACs inhibitor | 96017-59-3 |
4SC-202 | Class I HDAC inhibitor | 1186222-89-8 |
AR-42 (OSU-HDAC42) | HDAC inhibitor,novel and potent | 935881-37-1 |
Belinostat (PXD101) | Hydroxamate-type HDAC inhibitor | 414864-00-9 |
BML-210(CAY10433) | Novel HDAC inhibitor | 537034-17-6 |
BMS-345541(free base) | IKK-1/IKK-2 inhibitor,potent and selective | 445430-58-0 |
Chidamide | Novel HDAC inhibitor | 743420-02-2 |
CI994 (Tacedinaline) | HDAC inhibitor | 112522-64-2 |
CUDC-101 | Multitargeted HDAC inhibitor | 1012054-59-9 |
CUDC-907 | Potent PI3K/HDAC inhibitor | 1339928-25-4 |
Droxinostat | Selective HDAC inhibitor | 99873-43-5 |
Entinostat (MS-275,SNDX-275) | HDAC1 and HDAC3 inhibitor | 209783-80-2 |
HDAC Set I | ||
HPOB | HDAC6 inhibitor, potent and selective | 1429651-50-2 |
ITF2357 (Givinostat) | HDAC inhibitor | 732302-99-7 |
JNJ-26481585 | Potent HDAC inhibitor | 875320-29-9 |
KD 5170 | HDAC inhibitor | 940943-37-3 |
LAQ824 (NVP-LAQ824,Dacinostat) | HDAC inhibitor,potent and novel | 404951-53-7 |
M344 | HDAC inhibitor,potent and cell-permeable | 251456-60-7 |
Mocetinostat (MGCD0103, MG0103) | HDAC inhibitor,isotype-selective and potent | 726169-73-9 |
NCH 51 | Histone deacetylase (HDAC) inhibitor | 848354-66-5 |
NSC 3852 | HDAC inhibitor | 3565-26-2 |
Panobinostat (LBH589) | HDAC inhibitor | 404950-80-7 |
Parthenolide | 20554-84-1 | |
PCI-24781 (CRA-024781) | Pan-HDAC inhibitor | 783355-60-2 |
Pracinostat (SB939) | Pan-HDAC inhibitor | 929016-96-6 |
Pyroxamide | HDAC1 inhibitor | 382180-17-8 |
Resminostat (RAS2410) | Potent HDAC inhibitor | 864814-88-0 |
Resminostat hydrochloride | HDAC inhibitor | 1187075-34-8 |
RG2833 | Brain-penetrant HDAC inhibitor | 1215493-56-3 |
Romidepsin (FK228, depsipeptide) | HDAC1/HDAC2 inhibitor,potent and selective | 128517-07-7 |
Santacruzamate A (CAY10683) | 1477949-42-0 | |
SBHA | HDAC1/HDAC3 inhibitor,cell-permeable | 38937-66-5 |
Scriptaid | HDAC inhibitor,novel and cell-permeable | 287383-59-9 |
Sodium Phenylbutyrate | Histone deacetylase inhibitor | 1716-12-7 |
Suberohydroxamic Acid | HDAC inhibitor | 38937-66-5 |
TC-H 106 | HDAC inhibitor | 937039-45-7 |
Trichostatin A (TSA) | HDAC inhibitor | 58880-19-6 |
Tubacin | HDAC6 inhibitor,potent,selective,reversible,cell-permeable | 1350555-93-9 |
UF 010 | Novel and selective class I HDAC inhibitor | 537672-41-6 |
Valproic acid | HDAC1 inhibitor | 99-66-1 |
Valproic acid sodium salt (Sodium valproate) | HDAC inhibitor | 1069-66-5 |
Vorinostat (SAHA, MK0683) | HDAC inhibitor | 149647-78-9 |
Transcripts for HDAC1 Gene
mRNA/cDNA for HDAC1 Gene
- (2) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (849) Selected AceView cDNA sequences:
- (10) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for HDAC1
- genomics-online: gRNA clones - Search results for available HDAC1 gene related products
- Applied Biological Materials CRISPR for HDAC1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC1
- GenScript: Design CRISPR guide RNA sequences for HDAC1
miRNA Products
- Search ViGene Biosciences for HDAC1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
- genomics-online: shRNA clones - Search results for available HDAC1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
Clone Products
- Sino Biological Human cDNA Clone for HDAC1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HDAC1
- genomics-online: cdna clones - Search results for available HDAC1 gene related products
- orf clones - Search results for available HDAC1 gene related products
- Applied Biological Materials Clones for HDAC1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- Browse cDNA clones at Cloud-Clone Corp.
-
Cloud-Clone Corp. primers for HDAC1
ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6a | · | 6b | · | 6c | ^ | 7 | ^ | 8a | · | 8b | ^ | 9a | · | 9b | · | 9c | · | 9d | ^ | 10a | · | 10b | · | 10c | ^ | 11a | · | 11b | ^ | 12a | · | 12b | · | 12c | ^ | 13 | ^ | 14 | ^ |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP3: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP4: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SP7: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
SP8: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
SP9: |
ExUns: | 15 |
---|---|
SP1: | |
SP2: | |
SP3: | |
SP4: | |
SP5: | |
SP6: | |
SP7: | |
SP8: | |
SP9: |
Expression for HDAC1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HDAC1 Gene
NURSA nuclear receptor signaling pathways regulating expression of HDAC1 Gene:
HDAC1SOURCE GeneReport for Unigene cluster for HDAC1 Gene:
Hs.88556mRNA Expression by UniProt/SwissProt for HDAC1 Gene:
Q13547-HDAC1_HUMANEvidence on tissue expression from TISSUES for HDAC1 Gene
- Lung(4.8)
- Stomach(4.7)
- Blood(4.6)
- Liver(4.5)
- Intestine(4.2)
- Nervous system(3.7)
- Pancreas(2.8)
- Kidney(2.7)
- Heart(2.4)
- Lymph node(2.4)
- Muscle(2.4)
- Skin(2.4)
- Bone marrow(2.3)
- Thyroid gland(2.3)
- Eye(2.2)
Primer Products
-
OriGene qPCR primer pairs for HDAC1
-
OriGene qPCR primer pairs and template standards for HDAC1
- genomics-online: primer clones - Search results for available HDAC1 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC1 Gene
Orthologs for HDAC1 Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | HDAC1 33 34 |
|
||
mouse (Mus musculus) |
Mammalia | Gm10093 34 |
|
OneToMany | |
Hdac1 33 16 34 |
|
||||
oppossum (Monodelphis domestica) |
Mammalia | -- 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
dog (Canis familiaris) |
Mammalia | HDAC1 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | HDAC1 33 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Hdac1 33 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | HDAC1 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | HDAC1 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | HDAC1 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | hdac1 33 |
|
||
Str.6529 33 |
|
||||
zebrafish (Danio rerio) |
Actinopterygii | hdac1 34 |
|
OneToOne | |
-- 33 |
|
||||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP006511 33 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | Rpd3 35 33 34 |
|
||
HDAC3 35 |
|
|
|||
worm (Caenorhabditis elegans) |
Secernentea | hda-1 35 34 |
|
||
hda-3 33 34 |
|
||||
hda-2 35 |
|
|
|||
A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AGR395W 33 |
|
||
K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0E01981g 33 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | RPD3 33 34 36 |
|
||
thale cress (Arabidopsis thaliana) |
eudicotyledons | HD1 33 |
|
||
rice (Oryza sativa) |
Liliopsida | Os06g0583400 33 |
|
||
wheat (Triticum aestivum) |
Liliopsida | Ta.23826 33 |
|
||
corn (Zea mays) |
Liliopsida | Zm.13633 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | CSA.10476 34 |
|
OneToMany | |
fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | clr6 33 |
|
||
bread mold (Neurospora crassa) |
Ascomycetes | NCU00824 33 |
|
- Species where no ortholog for HDAC1 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
Paralogs for HDAC1 Gene
(5) SIMAP similar genes for HDAC1 Gene using alignment to 6 proteins:
Pseudogenes.org Pseudogenes for HDAC1 Gene
Variants for HDAC1 Gene
SNP ID | Clin | Chr 01 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs797044931 | likely-pathogenic, Inborn genetic diseases | 32,327,044(+) | A/G | 5_prime_UTR_variant, coding_sequence_variant, missense_variant | |
rs1000005850 | -- | 32,315,064(+) | T/C | intron_variant | |
rs1000043838 | -- | 32,294,025(+) | A/AA | intron_variant | |
rs1000112357 | -- | 32,322,444(+) | T/G | intron_variant | |
rs1000164454 | -- | 32,308,468(+) | A/T | intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
nsv1122326 | CNV | deletion | 24896259 |
nsv476322 | CNV | novel sequence insertion | 20440878 |
Additional Variant Information for HDAC1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC1 Gene
Disorders for HDAC1 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
atrichia with papular lesions |
|
|
retinoblastoma |
|
|
rett syndrome |
|
|
valproate embryopathy |
|
|
breast cancer |
|
Additional Disease Information for HDAC1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC1 Gene
Publications for HDAC1 Gene
- Chfr is linked to tumour metastasis through the downregulation of HDAC1. (PMID: 19182791) Oh YM … Seol JH (Nature cell biology 2009) 3 4 22 58
- Mechanisms of ceramide-mediated repression of the human telomerase reverse transcriptase promoter via deacetylation of Sp3 by histone deacetylase 1. (PMID: 17548428) Wooten-Blanks LG … Ogretmen B (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007) 3 4 22 58
- SENP1 enhances androgen receptor-dependent transcription through desumoylation of histone deacetylase 1. (PMID: 15199155) Cheng J … Yeh ET (Molecular and cellular biology 2004) 3 4 22 58
- Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation. (PMID: 11602581) Pflum MK … Schreiber SL (The Journal of biological chemistry 2001) 3 4 22 58
- HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins. (PMID: 10846170) Cai RL … Cohen D (The Journal of biological chemistry 2000) 3 4 22 58
Products for HDAC1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for HDAC1
- AM20512PU-N
- AM31794PU-N
- AM31795PU-N
- AM31796PU-N
- AM31797PU-N
- AP00270PU-N
- AP06155PU-N
- AP07556PU-N
- AP11121PU-N
- AP20947PU-N
- AP21036PU-N
- AP23098PU-N
- AP32221PU-N
- AP32235PU-N
- TA312925
- TA319251
- TA322691
- TA322692
- TA322693
- TA324515
- TA324609
- TA324678
- TA325167
- TA325506
- TA325507
- TA325508
- TA326790
- TA336336
- TA347134
- TA347135
- TA348969
- TA349072
- TA353865
- TA501999
- CF501999
- TA502028
- CF502028
- TA502142
- CF502142
- TA502143
- CF502143
- TA502193
- CF502193
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HDAC1
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC1
- Origene Custom Protein Services for HDAC1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
- OriGene qPCR primer pairs and template standards for HDAC1
- OriGene qPCR primer pairs for HDAC1
- OriGene CRISPR knockouts for HDAC1
- OriGene ORF clones in human for HDAC1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HDAC1
- GenScript: Next-day shipping of latest version cDNA ORF clones for HDAC1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for HDAC1
- GenScript Custom Assay Services for HDAC1
- GenScript Custom overexpressing Cell Line Services for HDAC1
- GenScript: Design CRISPR guide RNA sequences for HDAC1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for HDAC1
- Cell Signaling Technology (CST) Antibodies for HDAC1 (HDAC1)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for HDAC1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Sino Biological Antibodies for HDAC1
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for HDAC1
- Novus Biologicals proteins and lysates for HDAC1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for HDAC1
- Abcam proteins for HDAC1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for HDAC1
- Cloud-Clone Corp. Proteins for HDAC1
- Cloud-Clone Corp. Assay Kits for HDAC1
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Cloud-Clone Corp. primers for HDAC1
- Cloud-Clone Corp. primary cells service