Free for academic non-profit institutions. Other users need a Commercial license

HDAC1 Gene(Protein Coding)

Histone Deacetylase 1

GCID:
GC01P032260
GIFtS:
77
Genes Participants
UDN Logo

Aliases for HDAC1 Gene

Aliases for HDAC1 Gene

  • Histone Deacetylase 1 2 3 5
  • EC 3.5.1.98 4 61
  • RPD3L1 3 4
  • HD1 3 4
  • Reduced Potassium Dependency, Yeast Homolog-Like 1 3
  • GON-10 3
  • RPD3 3

External Ids for HDAC1 Gene

Previous HGNC Symbols for HDAC1 Gene

  • RPD3L1

Previous GeneCards Identifiers for HDAC1 Gene

  • GC01P032525
  • GC01P031697
  • GC01P032184
  • GC01P032426
  • GC01P032757
  • GC01P030873

Summaries for HDAC1 Gene

Entrez Gene Summary for HDAC1 Gene

  • Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]

GeneCards Summary for HDAC1 Gene

HDAC1 (Histone Deacetylase 1) is a Protein Coding gene. Diseases associated with HDAC1 include Atrichia With Papular Lesions and Retinoblastoma. Among its related pathways are Regulation of retinoblastoma protein and Regulation of nuclear SMAD2/3 signaling. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription factor binding. An important paralog of this gene is HDAC2.

UniProtKB/Swiss-Prot for HDAC1 Gene

  • Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.

Tocris Summary for HDAC1 Gene

  • Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.

Gene Wiki entry for HDAC1 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HDAC1 Gene

Genomics for HDAC1 Gene

Products:

  1. Regulatory Element

Regulatory Elements for HDAC1 Gene

Enhancers for HDAC1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01F031924 1.6 FANTOM5 ENCODE 10.6 -356.3 -356254 22.1 MLX CREB3L1 ZFP64 FEZF1 DMAP1 YBX1 YY1 SLC30A9 ZNF416 ZNF143 SNRNP40 ENSG00000229447 EIF3I TSSK3 MTMR9LP LOC105378626 KPNA6 ENSG00000224066 FAM167B KHDRBS1
GH01F032390 1.4 Ensembl ENCODE 11.9 +100.9 100914 5.2 HDGF PKNOX1 ARNT CREB3L1 ARID4B SIN3A DMAP1 YBX1 ZNF2 YY1 KPNA6 EIF3I ENSG00000224066 LOC105378629 MARCKSL1 HDAC1 FAM229A TSSK3 ENSG00000235790 BSDC1
GH01F031825 1.4 Ensembl ENCODE 10.6 -464.6 -464561 3.3 HDGF PKNOX1 ARNT CREB3L1 ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF766 SNRNP40 LOC105378626 ENSG00000229447 TSSK3 LOC400748 MTMR9LP ENSG00000224066 EIF3I FAM167B HDAC1
GH01F032319 1.3 Ensembl ENCODE 11.3 +29.5 29516 4.7 HDGF MLX ARID4B SIN3A DMAP1 ZNF48 YY1 ZNF121 ZNF143 FOS LOC105378629 HDAC1 EIF3I TMEM234 ENSG00000252450 DCDC2B ENSG00000224066 IQCC CCDC28B MTMR9LP
GH01F032132 1.3 Ensembl ENCODE 10.7 -158.7 -158676 2.3 HDGF PKNOX1 ARNT CREB3L1 SIN3A CBX5 ZNF548 FOS KLF13 REST SNRNP40 KPNA6 ENSG00000224066 ENSG00000229447 IQCC TSSK3 EIF3I CCDC28B DCDC2B TMEM234
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around HDAC1 on UCSC Golden Path with GeneCards custom track

Promoters for HDAC1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000076095 314 2001 HDGF PKNOX1 CREB3L1 ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF416

Transcription factor binding sites by QIAGEN in the HDAC1 gene promoter:

Genomic Location for HDAC1 Gene

Chromosome:
1
Start:
32,292,086 bp from pter
End:
32,333,635 bp from pter
Size:
41,550 bases
Orientation:
Plus strand

Genomic View for HDAC1 Gene

Genes around HDAC1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
HDAC1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for HDAC1 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for HDAC1 Gene

Proteins for HDAC1 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for HDAC1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13547-HDAC1_HUMAN
    Recommended name:
    Histone deacetylase 1
    Protein Accession:
    Q13547
    Secondary Accessions:
    • Q92534

    Protein attributes for HDAC1 Gene

    Size:
    482 amino acids
    Molecular mass:
    55103 Da
    Quaternary structure:
    • Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Found in a trimeric complex with APBB1 and TSHZ3; the interaction between HDAC1 and APBB1 is mediated by TSHZ3. Component of a RCOR/GFI/KDM1A/HDAC complex. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Associates with the 9-1-1 complex; interacts with HUS1. Found in a complex with DNMT3A and HDAC7. Interacts with the non-histone region of H2AFY. Interacts with TRIM28; the interaction recruits HDAC1 to E2F1 and inhibits its acetylation. Interacts with SP1; the interaction deacetylates SP1 and regulates its transcriptional activity. Interacts with SP3; the interaction deacetylates SP3 and regulates its transcriptional activity. In vitro, C(18) ceramides increase this interaction and the subsequent SP3 deacetylation and SP3-mediated repression of the TERT promoter. Interacts with TSHZ3 (via N-terminus); the interaction is direct. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with C10orf90/FATS (via its N-terminal); the interaction prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. Interacts with CDKN1A/p21. Interacts with CDK5 complexed to CDK5R1 (p25). Interacts directly with GFI1 and GFI1B. Interacts with NR1D2 (via C-terminus). Interacts with TSC22D3 isoform 1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity. Interacts with BAZ2A/TIP5, BANP, BCL6, BCOR, BHLHE40/DEC1, BRMS1, BRMS1L, CBFA2T3, CHFR, CIART, CRY1, DAXX, DDIT3/CHOP, DDX5, DNMT1, E4F1, EP300, HCFC1, HDAC9, INSM1, NFE4, NR4A2/NURR1, MIER1, KDM4A, KDM5B, KLF1, MINT, NRIP1, PCAF, PHB2, PRDM6, PRDM16, RB1, RERE, SAMSN1, SAP30L, SETDB1, SMAD3, SMARCA4/BRG1, SMYD2, SUV39H1, TGIF, TGIF2, TRAF6, UHRF1, UHRF2, ZMYND15, ZNF431 and ZNF541. Interacts with KDM5A (By similarity). Interacts with DNTTIP1 (PubMed:25653165). Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and ELMSAN1; this complex assembles into a tetramer that contains four copies of each protein chain (PubMed:25653165). Interacts with CCAR2 (PubMed:21030595). Interacts with PPHLN1 (PubMed:17963697). Found in a complex with YY1, SIN3A and GON4L (By similarity).

    Three dimensional structures from OCA and Proteopedia for HDAC1 Gene

neXtProt entry for HDAC1 Gene

Protein Expression for HDAC1 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for HDAC1 Gene

Q13547:
  • AVVLQCG
  • RLFENLRMLPHAPGVQ
  • HHGDGVEEAFY
  • DIGAGKGK
  • HPMKPHR
  • DIDIHHGDGV
  • LNYGLYR
  • GGLHHAKK
  • FVKSFNLPM
  • IRPDNMSEY
  • KVCYYYDGD
  • DRLGCFNL
  • LRDGIDD
  • RCWTYET
  • NELPYNDYFEYFGPDFKLHISPSNMTNQNT
  • PDKRISI
  • DGIDDESY
  • KGHAKCVE
  • EYLEKIK
  • LELLKYH
  • SDKRIAC
  • GGGGYTIRNV
  • DRVMTVSFH
  • NFKKAKRVKTE
  • FNVGEDCP
  • VSFHKYG
  • RVLYIDID
  • AVKLNKQ
  • GEYFPGTG

Post-translational modifications for HDAC1 Gene

  • Phosphorylation on Ser-421 and Ser-423 promotes enzymatic activity and interactions with NuRD and SIN3 complexes. Phosphorylated by CDK5.
  • Sumoylated on Lys-444 and Lys-476; which promotes enzymatic activity. Desumoylated by SENP1.
  • Ubiquitinated by CHFR, leading to its degradation by the proteasome. Ubiquitinated by KCTD11, leading to proteasomal degradation.
  • Ubiquitination at Lys 10, Lys 66, Lys 74, Lys 126, Lys 279, and Lys 361
  • Modification sites at PhosphoSitePlus

Other Protein References for HDAC1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for HDAC1 Gene

Gene Families for HDAC1 Gene

HGNC:

Protein Domains for HDAC1 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for HDAC1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q13547

UniProtKB/Swiss-Prot:

HDAC1_HUMAN :
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
Family:
  • Belongs to the histone deacetylase family. HD type 1 subfamily.
genes like me logo Genes that share domains with HDAC1: view

Function for HDAC1 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for HDAC1 Gene

GENATLAS Biochemistry:
histone deacetyltransferase 1,modulator of chromatin structure,involved in repression of gene expression,through interaction with RB1,also downregulating MEF2 activity after being recruited by MITR
UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
UniProtKB/Swiss-Prot Function:
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.

Enzyme Numbers (IUBMB) for HDAC1 Gene

Gene Ontology (GO) - Molecular Function for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000976 transcription regulatory region sequence-specific DNA binding ISS --
GO:0000978 contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding IDA 16217013
GO:0000980 contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding IDA 16217013
GO:0001047 core promoter binding IDA 18974119
GO:0001085 RNA polymerase II transcription factor binding IPI 18936100
genes like me logo Genes that share ontologies with HDAC1: view
genes like me logo Genes that share phenotypes with HDAC1: view

Animal Models for HDAC1 Gene

MGI Knock Outs for HDAC1:

Animal Model Products

  • Taconic Biosciences Mouse Models for HDAC1

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for HDAC1

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC1 Gene

Localization for HDAC1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for HDAC1 Gene

Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for HDAC1 gene
Compartment Confidence
nucleus 5
cytosol 5
extracellular 1
cytoskeleton 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000118 histone deacetylase complex TAS 12711221
GO:0000785 chromatin IDA 16731528
GO:0000790 nuclear chromatin IDA 16217013
GO:0005634 nucleus IDA 10846170
GO:0005654 nucleoplasm TAS --
genes like me logo Genes that share ontologies with HDAC1: view

Pathways & Interactions for HDAC1 Gene

SuperPathways for HDAC1 Gene

PathCards logo More details on SuperPathways for HDAC1
SuperPathway Contained pathways
1 Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3
Positive epigenetic regulation of rRNA expression
.86
NoRC negatively regulates rRNA expression
.83
RNA Polymerase I Transcription
.81
Negative epigenetic regulation of rRNA expression
.81
RNA Polymerase I Promoter Clearance
.81
ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression
.76
RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
.75
Epigenetic regulation of gene expression
.73
Formation of the beta-catenin-TCF transactivating complex
.64
HDACs deacetylate histones
.60
Alcoholism
.34
2 Signaling by NOTCH1
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
.78
Constitutive Signaling by NOTCH1 PEST Domain Mutants
.78
Signaling by NOTCH1
.78
Signaling by NOTCH1 HD+PEST Domain Mutants in Cancer
.78
Signaling by NOTCH1 in Cancer
.78
Signaling by NOTCH1 PEST Domain Mutants in Cancer
.78
NOTCH1 Intracellular Domain Regulates Transcription
.68
Signaling by NOTCH
.65
3 Notch signaling pathway (KEGG)
Notch signaling pathway
.83
Notch Signaling Pathway
.83
Delta-Notch Signaling Pathway
.41
Notch signaling pathway
.36
Notch Signaling Pathways
.31
Notch Signaling
.30
4 Transcriptional activity of SMAD2/SMAD3-SMAD4 heterotrimer
SMAD2/SMAD3-SMAD4 heterotrimer regulates transcription
.74
Transcriptional activity of SMAD2/SMAD3-SMAD4 heterotrimer
.74
Signaling by TGF-beta Receptor Complex
.60
Downregulation of SMAD2/3-SMAD4 transcriptional activity
.50
5 p53 Signaling
p53 Pathway
.44
p53 Pathway
.44
p53 Signaling
.44
genes like me logo Genes that share pathways with HDAC1: view

SIGNOR curated interactions for HDAC1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for HDAC1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter TAS --
GO:0006325 chromatin organization TAS 12711221
GO:0006338 chromatin remodeling IC 16762839
GO:0006346 methylation-dependent chromatin silencing IGI 23770133
GO:0006351 transcription, DNA-templated IEA --
genes like me logo Genes that share ontologies with HDAC1: view

Drugs & Compounds for HDAC1 Gene

Products:

  1. Drug

(86) Drugs for HDAC1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Romidepsin Approved, Investigational Pharma inhibitor, Target, antagonist Histone deacetylase (HDAC)inhibitors 84
Valproic Acid Approved, Investigational Pharma inhibitor HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors 322
Sodium phenylbutyrate Approved Pharma Inhibitor Histone deacetylase inhibitor, Histone deacetylase (HDAC)inhibitors 0
Belinostat Approved, Investigational Pharma Inhibitor, Target Histone deacetylase (HDAC)inhibitors 42
Panobinostat Approved, Investigational Pharma Inhibition, inhibitor, Target Histone deacetylase (HDAC)inhibitors 136

(19) Additional Compounds for HDAC1 Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
FK 228
128517-07-7
MC 1742
1776116-74-5
SAHA
149647-78-9

(5) Tocris Compounds for HDAC1 Gene

Compound Action Cas Number
FK 228 Potent and selective class I histone deacetylase inhibitor; antitumor 128517-07-7
MC 1568 Selective HDAC class II (IIa) inhibitor 852475-26-4
MC 1742 Potent class I and IIb HDAC inhibitor 1776116-74-5
SAHA Class I and II HDAC inhibitor 149647-78-9
Trichostatin A Potent histone deacetylase inhibitor 58880-19-6

(43) ApexBio Compounds for HDAC1 Gene

Compound Action Cas Number
2-hexyl-4-Pentynoic Acid Potent and robust HDACs inhibitor 96017-59-3
4SC-202 Class I HDAC inhibitor 1186222-89-8
AR-42 (OSU-HDAC42) HDAC inhibitor,novel and potent 935881-37-1
Belinostat (PXD101) Hydroxamate-type HDAC inhibitor 414864-00-9
BML-210(CAY10433) Novel HDAC inhibitor 537034-17-6
BMS-345541(free base) IKK-1/IKK-2 inhibitor,potent and selective 445430-58-0
Chidamide Novel HDAC inhibitor 743420-02-2
CI994 (Tacedinaline) HDAC inhibitor 112522-64-2
CUDC-101 Multitargeted HDAC inhibitor 1012054-59-9
CUDC-907 Potent PI3K/HDAC inhibitor 1339928-25-4
Droxinostat Selective HDAC inhibitor 99873-43-5
Entinostat (MS-275,SNDX-275) HDAC1 and HDAC3 inhibitor 209783-80-2
HDAC Set I
HPOB HDAC6 inhibitor, potent and selective 1429651-50-2
ITF2357 (Givinostat) HDAC inhibitor 732302-99-7
JNJ-26481585 Potent HDAC inhibitor 875320-29-9
KD 5170 HDAC inhibitor 940943-37-3
LAQ824 (NVP-LAQ824,Dacinostat) HDAC inhibitor,potent and novel 404951-53-7
M344 HDAC inhibitor,potent and cell-permeable 251456-60-7
Mocetinostat (MGCD0103, MG0103) HDAC inhibitor,isotype-selective and potent 726169-73-9
NCH 51 Histone deacetylase (HDAC) inhibitor 848354-66-5
NSC 3852 HDAC inhibitor 3565-26-2
Panobinostat (LBH589) HDAC inhibitor 404950-80-7
Parthenolide 20554-84-1
PCI-24781 (CRA-024781) Pan-HDAC inhibitor 783355-60-2
Pracinostat (SB939) Pan-HDAC inhibitor 929016-96-6
Pyroxamide HDAC1 inhibitor 382180-17-8
Resminostat (RAS2410) Potent HDAC inhibitor 864814-88-0
Resminostat hydrochloride HDAC inhibitor 1187075-34-8
RG2833 Brain-penetrant HDAC inhibitor 1215493-56-3
Romidepsin (FK228, depsipeptide) HDAC1/HDAC2 inhibitor,potent and selective 128517-07-7
Santacruzamate A (CAY10683) 1477949-42-0
SBHA HDAC1/HDAC3 inhibitor,cell-permeable 38937-66-5
Scriptaid HDAC inhibitor,novel and cell-permeable 287383-59-9
Sodium Phenylbutyrate Histone deacetylase inhibitor 1716-12-7
Suberohydroxamic Acid HDAC inhibitor 38937-66-5
TC-H 106 HDAC inhibitor 937039-45-7
Trichostatin A (TSA) HDAC inhibitor 58880-19-6
Tubacin HDAC6 inhibitor,potent,selective,reversible,cell-permeable 1350555-93-9
UF 010 Novel and selective class I HDAC inhibitor 537672-41-6
Valproic acid HDAC1 inhibitor 99-66-1
Valproic acid sodium salt (Sodium valproate) HDAC inhibitor 1069-66-5
Vorinostat (SAHA, MK0683) HDAC inhibitor 149647-78-9
genes like me logo Genes that share compounds with HDAC1: view

Drug Products

Transcripts for HDAC1 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for HDAC1 Gene

(2) REFSEQ mRNAs :
(14) Additional mRNA sequences :
(849) Selected AceView cDNA sequences:
(10) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for HDAC1 Gene

Histone deacetylase 1:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for HDAC1

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for HDAC1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c · 9d ^ 10a · 10b · 10c ^ 11a · 11b ^ 12a · 12b · 12c ^ 13 ^ 14 ^
SP1: - - - - - -
SP2:
SP3: - - -
SP4: - - -
SP5: - -
SP6:
SP7: -
SP8: - -
SP9:

ExUns: 15
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:

Relevant External Links for HDAC1 Gene

GeneLoc Exon Structure for
HDAC1
ECgene alternative splicing isoforms for
HDAC1

Expression for HDAC1 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for HDAC1 Gene

mRNA expression in normal human tissues for HDAC1 Gene
mRNA expression by BioGPS for HDAC1 GenemRNA expression by GTEx for HDAC1 Gene

Protein differential expression in normal tissues from HIPED for HDAC1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (12.1) and Lymph node (6.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HDAC1 Gene



Protein tissue co-expression partners for HDAC1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of HDAC1 Gene:

HDAC1

SOURCE GeneReport for Unigene cluster for HDAC1 Gene:

Hs.88556

mRNA Expression by UniProt/SwissProt for HDAC1 Gene:

Q13547-HDAC1_HUMAN
Tissue specificity: Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.
genes like me logo Genes that share expression patterns with HDAC1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for HDAC1 Gene

Orthologs for HDAC1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for HDAC1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia HDAC1 34 35
  • 99.45 (n)
mouse
(Mus musculus)
 Mammalia Gm10093 35
  • 99 (a)
 OneToMany
Hdac1 34 16 35
  • 90.46 (n)
oppossum
(Monodelphis domestica)
 Mammalia -- 35
  • 96 (a)
 OneToMany
-- 35
  • 62 (a)
 OneToMany
dog
(Canis familiaris)
 Mammalia HDAC1 34 35
  • 94.12 (n)
cow
(Bos Taurus)
 Mammalia HDAC1 34 35
  • 93.91 (n)
rat
(Rattus norvegicus)
 Mammalia Hdac1 34
  • 90.94 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia HDAC1 35
  • 89 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves HDAC1 34 35
  • 81.45 (n)
lizard
(Anolis carolinensis)
 Reptilia HDAC1 35
  • 92 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia hdac1 34
  • 79.18 (n)
Str.6529 34
zebrafish
(Danio rerio)
 Actinopterygii hdac1 35
  • 90 (a)
 OneToOne
-- 34
African malaria mosquito
(Anopheles gambiae)
 Insecta AgaP_AGAP006511 34
  • 72.76 (n)
fruit fly
(Drosophila melanogaster)
 Insecta Rpd3 34 35 36
  • 72.17 (n)
HDAC3 36
  • 57 (a)
worm
(Caenorhabditis elegans)
 Secernentea hda-1 36 35
  • 64 (a)
hda-3 34 35
  • 63.51 (n)
hda-2 36
  • 51 (a)
A. gosspyii yeast
(Ashbya gossypii)
 Saccharomycetes AGOS_AGR395W 34
  • 62.19 (n)
K. lactis yeast
(Kluyveromyces lactis)
 Saccharomycetes KLLA0E01981g 34
  • 61.15 (n)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes RPD3 34 35 37
  • 60.28 (n)
thale cress
(Arabidopsis thaliana)
 eudicotyledons HD1 34
  • 63.36 (n)
rice
(Oryza sativa)
 Liliopsida Os06g0583400 34
  • 65.37 (n)
wheat
(Triticum aestivum)
 Liliopsida Ta.23826 34
corn
(Zea mays)
 Liliopsida Zm.13633 34
sea squirt
(Ciona savignyi)
 Ascidiacea CSA.10476 35
  • 83 (a)
 OneToMany
fission yeast
(Schizosaccharomyces pombe)
 Schizosaccharomycetes clr6 34
  • 63.16 (n)
bread mold
(Neurospora crassa)
 Ascomycetes NCU00824 34
  • 62.75 (n)
Species where no ortholog for HDAC1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for HDAC1 Gene

ENSEMBL:
Gene Tree for HDAC1 (if available)
TreeFam:
Gene Tree for HDAC1 (if available)

Paralogs for HDAC1 Gene

Paralogs for HDAC1 Gene

(5) SIMAP similar genes for HDAC1 Gene using alignment to 6 proteins:

Pseudogenes.org Pseudogenes for HDAC1 Gene

genes like me logo Genes that share paralogs with HDAC1: view

Variants for HDAC1 Gene

Sequence variations from dbSNP and Humsavar for HDAC1 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs797044931 Pathogenic 32,327,044(+) CGTCA(A/G)TGATA reference, missense, utr-variant-5-prime
rs10465520 -- 32,322,294(+) tctcc(C/T)gagat intron-variant
rs10465521 -- 32,322,329(+) tggaa(C/T)gcagg intron-variant
rs10465522 -- 32,320,719(+) gcgtg(C/G)tgaaa intron-variant
rs10652556 -- 32,309,681(+) AAAAA(-/A)CAAGC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for HDAC1 Gene

Variant ID Type Subtype PubMed ID
nsv1122326 CNV deletion 24896259
nsv476322 CNV novel sequence insertion 20440878

Variation tolerance for HDAC1 Gene

Residual Variation Intolerance Score: 17.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.58; 65.16% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for HDAC1 Gene

Human Gene Mutation Database (HGMD)
HDAC1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
HDAC1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC1 Gene

Disorders for HDAC1 Gene

MalaCards: The human disease database

(7) MalaCards diseases for HDAC1 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
atrichia with papular lesions
  • apl
retinoblastoma
  • retinoblastoma, trilateral
rett syndrome
  • rett syndrome, preserved speech variant
valproate embryopathy, susceptibility to
  • fetal valproate syndrome
breast cancer
  • breast cancer, invasive ductal
- elite association - COSMIC cancer census association via MalaCards
Search HDAC1 in MalaCards View complete list of genes associated with diseases

Relevant External Links for HDAC1

Genetic Association Database (GAD)
HDAC1
Human Genome Epidemiology (HuGE) Navigator
HDAC1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
HDAC1
genes like me logo Genes that share disorders with HDAC1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC1 Gene

Publications for HDAC1 Gene

  1. Chfr is linked to tumour metastasis through the downregulation of HDAC1. (PMID: 19182791) Oh Y.M. … Seol J.H. (Nat. Cell Biol. 2009) 3 4 22 64
  2. Mechanisms of ceramide-mediated repression of the human telomerase reverse transcriptase promoter via deacetylation of Sp3 by histone deacetylase 1. (PMID: 17548428) Wooten-Blanks L.G. … Ogretmen B. (FASEB J. 2007) 3 4 22 64
  3. SENP1 enhances androgen receptor-dependent transcription through desumoylation of histone deacetylase 1. (PMID: 15199155) Cheng J. … Yeh E.T.H. (Mol. Cell. Biol. 2004) 3 4 22 64
  4. Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation. (PMID: 11602581) Pflum M.K.H. … Schreiber S.L. (J. Biol. Chem. 2001) 3 4 22 64
  5. HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins. (PMID: 10846170) Cai R.L. … Cohen D. (J. Biol. Chem. 2000) 3 4 22 64

Products for HDAC1 Gene

  • Addgene plasmids for HDAC1

Sources for HDAC1 Gene