Aliases for HDAC1 Gene
Aliases for HDAC1 Gene
External Ids for HDAC1 Gene
- HGNC: 4852
- Entrez Gene: 3065
- Ensembl: ENSG00000116478
- OMIM: 601241
- UniProtKB: Q13547
Previous HGNC Symbols for HDAC1 Gene
- RPD3L1
Previous GeneCards Identifiers for HDAC1 Gene
- GC01P032525
- GC01P031697
- GC01P032184
- GC01P032426
- GC01P032757
- GC01P030873
Summaries for HDAC1 Gene
-
Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]
GeneCards Summary for HDAC1 Gene
HDAC1 (Histone Deacetylase 1) is a Protein Coding gene. Diseases associated with HDAC1 include Atrichia With Papular Lesions and Rett Syndrome. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and PEDF Induced Signaling. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription factor binding. An important paralog of this gene is HDAC2.
UniProtKB/Swiss-Prot for HDAC1 Gene
-
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
-
Histone deacetylases (HDACs) are a group of enzymes closely related to sirtuins. They catalyze acetyl group removal from lysine residues in histones and non-histone proteins, causing transcriptional repression. HDACs are usually components of multiprotein complexes.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for HDAC1 Gene
Genomics for HDAC1 Gene
Regulatory Elements for HDAC1 Gene
Enhancers for HDAC1 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around HDAC1 on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the HDAC1 gene promoter:
Regulatory Element Products
Genomic Location for HDAC1 Gene
- Chromosome:
- 1
- Start:
- 32,292,086 bp from pter
- End:
- 32,333,635 bp from pter
- Size:
- 41,550 bases
- Orientation:
- Plus strand
Genomic View for HDAC1 Gene
Genes around HDAC1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 1p35.2 by Ensembl
- 1p35.2-p35.1 by Entrez Gene
- 1p35.2-p35.1 by HGNC
HDAC1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for HDAC1 Gene
Proteins for HDAC1 Gene
-
Protein details for HDAC1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13547-HDAC1_HUMAN
- Recommended name:
- Histone deacetylase 1
- Protein Accession:
- Q13547
- Q92534
Protein attributes for HDAC1 Gene
- Size:
- 482 amino acids
- Molecular mass:
- 55103 Da
- Quaternary structure:
-
- Part of the core histone deacetylase (HDAC) complex composed of HDAC1, HDAC2, RBBP4 and RBBP7. The core complex associates with MTA2, MBD2, MBD3, MTA1L1, CHD3 and CHD4 to form the nucleosome remodeling and histone deacetylation (NuRD) complex, or with SIN3, SAP18 and SAP30 to form the SIN3 HDAC complex. Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Component of a mSin3A corepressor complex that contains SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1 and HDAC2. Found in a trimeric complex with APBB1 and TSHZ3; the interaction between HDAC1 and APBB1 is mediated by TSHZ3. Component of a RCOR/GFI/KDM1A/HDAC complex. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2. The large PER complex involved in the histone deacetylation is composed of at least HDAC1, PER2, SFPQ and SIN3A. Associates with the 9-1-1 complex; interacts with HUS1. Found in a complex with DNMT3A and HDAC7. Interacts with the non-histone region of H2AFY. Interacts with TRIM28; the interaction recruits HDAC1 to E2F1 and inhibits its acetylation. Interacts with SP1; the interaction deacetylates SP1 and regulates its transcriptional activity. Interacts with SP3; the interaction deacetylates SP3 and regulates its transcriptional activity. In vitro, C(18) ceramides increase this interaction and the subsequent SP3 deacetylation and SP3-mediated repression of the TERT promoter. Interacts with TSHZ3 (via N-terminus); the interaction is direct. Interacts with APEX1; the interaction is not dependent on the acetylated status of APEX1. Interacts with C10orf90/FATS (via its N-terminal); the interaction prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. Interacts with CDKN1A/p21. Interacts with CDK5 complexed to CDK5R1 (p25). Interacts directly with GFI1 and GFI1B. Interacts with NR1D2 (via C-terminus). Interacts with TSC22D3 isoform 1; this interaction affects HDAC1 activity on MYOG promoter and thus inhibits MYOD1 transcriptional activity. Interacts with BAZ2A/TIP5, BANP, BCL6, BCOR, BHLHE40/DEC1, BRMS1, BRMS1L, CBFA2T3, CHFR, CIART, CRY1, DAXX, DDIT3/CHOP, DDX5, DNMT1, E4F1, EP300, HCFC1, HDAC9, INSM1, NFE4, NR4A2/NURR1, MIER1, KDM4A, KDM5B, KLF1, MINT, NRIP1, PCAF, PHB2, PRDM6, PRDM16, RB1, RERE, SAMSN1, SAP30L, SETDB1, SMAD3, SMARCA4/BRG1, SMYD2, SUV39H1, TGIF, TGIF2, TRAF6, UHRF1, UHRF2, ZMYND15, ZNF431 and ZNF541. Interacts with KDM5A (By similarity). Interacts with DNTTIP1 (PubMed:25653165). Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and ELMSAN1; this complex assembles into a tetramer that contains four copies of each protein chain (PubMed:25653165). Interacts with CCAR2 (PubMed:21030595). Interacts with PPHLN1 (PubMed:17963697). Found in a complex with YY1, SIN3A and GON4L (By similarity). Interacts with CHD4 (PubMed:27616479).
Protein Expression for HDAC1 Gene
Selected DME Specific Peptides for HDAC1 Gene
- Q13547:
-
- AVVLQCG
- RLFENLRMLPHAPGVQ
- HHGDGVEEAFY
- DIGAGKGK
- HPMKPHR
- DIDIHHGDGV
- LNYGLYR
- GGLHHAKK
- FVKSFNLPM
- IRPDNMSEY
- KVCYYYDGD
- DRLGCFNL
- LRDGIDD
- RCWTYET
- NELPYNDYFEYFGPDFKLHISPSNMTNQNT
- PDKRISI
- DGIDDESY
- KGHAKCVE
- EYLEKIK
- LELLKYH
- SDKRIAC
- GGGGYTIRNV
- DRVMTVSFH
- NFKKAKRVKTE
- FNVGEDCP
- VSFHKYG
- RVLYIDID
- AVKLNKQ
- GEYFPGTG
Post-translational modifications for HDAC1 Gene
- Phosphorylation on Ser-421 and Ser-423 promotes enzymatic activity and interactions with NuRD and SIN3 complexes. Phosphorylated by CDK5.
- Sumoylated on Lys-444 and Lys-476; which promotes enzymatic activity. Desumoylated by SENP1.
- Ubiquitinated by CHFR, leading to its degradation by the proteasome. Ubiquitinated by KCTD11, leading to proteasomal degradation.
- Ubiquitination at isoforms=10, posLast=6666, posLast=7474, posLast=126126, posLast=279279, and posLast=361361
- Modification sites at PhosphoSitePlus
Other Protein References for HDAC1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore top HDAC1 Antibody
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for HDAC1
- Cell Signaling Technology (CST) Antibodies for HDAC1 (HDAC1)
-
Custom Antibody ServicesOriGene Antibodies for HDAC1
- AM20512PU-N
- AM31794PU-N
- CF502193
- TA502193
- CF502143
- TA502143
- CF502142
- TA502142
- CF502028
- TA502028
- CF501999
- TA501999
- TA353865
- TA352611
- TA349072
- TA348969
- TA347135
- TA347134
- TA336336
- TA326790
- TA325508
- TA325507
- TA325506
- TA325167
- TA324678
- TA324609
- TA324515
- TA322693
- TA322692
- TA322691
- TA319251
- TA312925
- TA312924
- TA312923
- AP32235PU-N
- AP32221PU-N
- AP23098PU-N
- AP21036PU-N
- AP20947PU-N
- AP15592PU-S
- AP15592PU-N
- AP15592PU-M
- AP11121PU-N
- AP07556PU-N
- AP06155PU-N
- AP00270PU-N
- AM31797PU-N
- AM31796PU-N
- AM31795PU-N
- Novus Biologicals Antibodies for HDAC1
- Invitrogen Antibodies for HDAC1
- antibodies-online Antibodies for HDAC1: See all 391
- GeneTex HDAC1 antibody for HDAC1
-
Custom Antibody ServicesProSci Antibodies for HDAC1
-
Santa Cruz Biotechnology (SCBT) Antibodies for HDAC1
Protein Products
- EMD Millipore Purified and/or Recombinant HDAC1 Protein
- Enzo Life Sciences proteins for HDAC1
-
OriGene Purified Proteins for HDAC1
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC1
- Origene Custom Protein Services for HDAC1
- antibodies-online Proteins for HDAC1: See all 21
- Search antibodies-online for peptides
- Search GeneTex for Proteins for HDAC1
-
Abcam proteins for HDAC1
Assay Products
- EMD Millipore Kits and Assays for HDAC1
- Enzo Life Sciences assays for HDAC1
-
Cloud-Clone Corp Assay Kits for HDAC1
- antibodies-online Kits for HDAC1: See all 19
Domains & Families for HDAC1 Gene
Gene Families for HDAC1 Gene
Protein Domains for HDAC1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for HDAC1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q13547- Family:
-
- Belongs to the histone deacetylase family. HD type 1 subfamily.
Function for HDAC1 Gene
Molecular function for HDAC1 Gene
- GENATLAS Biochemistry:
- histone deacetyltransferase 1,modulator of chromatin structure,involved in repression of gene expression,through interaction with RB1,also downregulating MEF2 activity after being recruited by MITR
- UniProtKB/Swiss-Prot CatalyticActivity:
- Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone.
- UniProtKB/Swiss-Prot Function:
- Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates Lys-310 in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation.
Enzyme Numbers (IUBMB) for HDAC1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000976 | transcription regulatory region sequence-specific DNA binding | ISS | -- |
| GO:0000978 | contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding | IDA | 16217013 |
| GO:0000980 | contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding | IDA | 16217013 |
| GO:0001046 | core promoter sequence-specific DNA binding | IDA | 23629966 |
| GO:0001047 | core promoter binding | IDA | 18974119 |
Phenotypes for HDAC1 Gene
- MGI mutant phenotypes for HDAC1:
-
inferred from 9 alleles
- mortality/aging
- cellular phenotype
- behavior/neurological phenotype
- normal phenotype
- growth/size/body region phenotype
- immune system phenotype
- muscle phenotype
- cardiovascular system phenotype
- respiratory system phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- vision/eye phenotype
- integument phenotype
- limbs/digits/tail phenotype
- embryo phenotype
- pigmentation phenotype
- hematopoietic system phenotype
- liver/biliary system phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for HDAC1:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Increased gamma-H2AX phosphorylation
- Decreased ionizing radiation sensitivity
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Decreased NF-kappaB reporter expression
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with MLN4924 (a NAE inhibitor)
- Upregulation of Wnt/beta-catenin pathway after WNT3A stimulation
- Decreased HIV-1 infection
Animal Model Products
-
Taconic Biosciences Mouse Models for HDAC1
- Cyagen custom Knockout/knockin (KOKI) mouse models for HDAC1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
- Search ViGene Biosciences for HDAC1
CRISPR Products
-
OriGene CRISPR knockouts for HDAC1
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC1
- GenScript: Design CRISPR guide RNA sequences for HDAC1
miRNA for HDAC1 Gene
- miRTarBase miRNAs that target HDAC1
miRNA Products
- Search ViGene Biosciences for HDAC1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
Clone Products
-
OriGene ORF clones in human for HDAC1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for HDAC1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HDAC1
- VectorBuilder custom plasmid, inducible vectors for HDAC1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for HDAC1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for HDAC1
-
ViGene Biosciences adenoviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for HDAC1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-12119) for HDAC1
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for HDAC1 Gene
Localization for HDAC1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for HDAC1 Gene
- Nucleus.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| extracellular | 1 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000118 | histone deacetylase complex | TAS | 12711221 |
| GO:0000785 | chromatin | IDA | 16731528 |
| GO:0000790 | nuclear chromatin | IDA | 16217013 |
| GO:0005634 | nucleus | IDA | 10846170 |
| GO:0005654 | nucleoplasm | TAS | -- |
Pathways & Interactions for HDAC1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 |
.34
|
|
| 2 | Signaling by NOTCH1 | ||
| 3 | Notch signaling pathway (KEGG) |
.30
|
|
| 4 | Transcriptional activity of SMAD2/SMAD3-SMAD4 heterotrimer | ||
| 5 | p53 Signaling |
.44
.44
|
.44
|
Pathways by source for HDAC1 Gene
3 Sino Biological pathways for HDAC1 Gene
2 GeneTex pathways for HDAC1 Gene
1 Cell Signaling Technology pathway for HDAC1 Gene
31 BioSystems pathways for HDAC1 Gene
47 Reactome pathways for HDAC1 Gene
1 PharmGKB pathway for HDAC1 Gene
13 KEGG pathways for HDAC1 Gene
8 GeneGo (Thomson Reuters) pathways for HDAC1 Gene
2 R&D Systems pathways for HDAC1 Gene
17 Qiagen pathways for HDAC1 Gene
Interacting Proteins for HDAC1 Gene
Selected Interacting proteins:
Q13547-HDAC1_HUMAN
ENSP00000362649
for HDAC1 Gene via
MINT
STRING
IID
UniProtKB
SIGNOR curated interactions for HDAC1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | TAS | -- |
| GO:0006325 | chromatin organization | TAS | 12711221 |
| GO:0006338 | chromatin remodeling | IC | 16762839 |
| GO:0006346 | methylation-dependent chromatin silencing | IGI | 23770133 |
| GO:0006351 | transcription, DNA-templated | IEA | -- |
Drugs & Compounds for HDAC1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Romidepsin | Approved, Investigational | Pharma | inhibitor, Target, antagonist | Histone deacetylase (HDAC)inhibitors | 87 | |
| Valproic Acid | Approved, Investigational | Pharma | inhibitor | HDAC1 inhibitor, Histone deacetylase (HDAC)inhibitors | 327 | |
| Sodium phenylbutyrate | Approved | Pharma | Inhibitor | Histone deacetylase inhibitor, Histone deacetylase (HDAC)inhibitors | 0 | |
| Belinostat | Approved, Investigational | Pharma | Inhibitor, Target | Histone deacetylase (HDAC)inhibitors | 42 | |
| Panobinostat | Approved, Investigational | Pharma | Inhibition, inhibitor, Target | Histone deacetylase (HDAC)inhibitors | 135 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| FK 228 |
|
128517-07-7 |
|
|
||
| MC 1742 |
|
1776116-74-5 |
|
|
||
| SAHA |
|
149647-78-9 |
|
|
(5) Tocris Compounds for HDAC1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| FK 228 | Potent and selective class I histone deacetylase inhibitor; antitumor | 128517-07-7 |
| MC 1568 | Selective HDAC class II (IIa) inhibitor | 852475-26-4 |
| MC 1742 | Potent class I and IIb HDAC inhibitor | 1776116-74-5 |
| SAHA | Class I and II HDAC inhibitor | 149647-78-9 |
| Trichostatin A | Potent histone deacetylase inhibitor | 58880-19-6 |
(43) ApexBio Compounds for HDAC1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| 2-hexyl-4-Pentynoic Acid | Potent and robust HDACs inhibitor | 96017-59-3 |
| 4SC-202 | Class I HDAC inhibitor | 1186222-89-8 |
| AR-42 (OSU-HDAC42) | HDAC inhibitor,novel and potent | 935881-37-1 |
| Belinostat (PXD101) | Hydroxamate-type HDAC inhibitor | 414864-00-9 |
| BML-210(CAY10433) | Novel HDAC inhibitor | 537034-17-6 |
| BMS-345541(free base) | IKK-1/IKK-2 inhibitor,potent and selective | 445430-58-0 |
| Chidamide | Novel HDAC inhibitor | 743420-02-2 |
| CI994 (Tacedinaline) | HDAC inhibitor | 112522-64-2 |
| CUDC-101 | Multitargeted HDAC inhibitor | 1012054-59-9 |
| CUDC-907 | Potent PI3K/HDAC inhibitor | 1339928-25-4 |
| Droxinostat | Selective HDAC inhibitor | 99873-43-5 |
| Entinostat (MS-275,SNDX-275) | HDAC1 and HDAC3 inhibitor | 209783-80-2 |
| HDAC Set I | ||
| HPOB | HDAC6 inhibitor, potent and selective | 1429651-50-2 |
| ITF2357 (Givinostat) | HDAC inhibitor | 732302-99-7 |
| JNJ-26481585 | Potent HDAC inhibitor | 875320-29-9 |
| KD 5170 | HDAC inhibitor | 940943-37-3 |
| LAQ824 (NVP-LAQ824,Dacinostat) | HDAC inhibitor,potent and novel | 404951-53-7 |
| M344 | HDAC inhibitor,potent and cell-permeable | 251456-60-7 |
| Mocetinostat (MGCD0103, MG0103) | HDAC inhibitor,isotype-selective and potent | 726169-73-9 |
| NCH 51 | Histone deacetylase (HDAC) inhibitor | 848354-66-5 |
| NSC 3852 | HDAC inhibitor | 3565-26-2 |
| Panobinostat (LBH589) | HDAC inhibitor | 404950-80-7 |
| Parthenolide | 20554-84-1 | |
| PCI-24781 (CRA-024781) | Pan-HDAC inhibitor | 783355-60-2 |
| Pracinostat (SB939) | Pan-HDAC inhibitor | 929016-96-6 |
| Pyroxamide | HDAC1 inhibitor | 382180-17-8 |
| Resminostat (RAS2410) | Potent HDAC inhibitor | 864814-88-0 |
| Resminostat hydrochloride | HDAC inhibitor | 1187075-34-8 |
| RG2833 | Brain-penetrant HDAC inhibitor | 1215493-56-3 |
| Romidepsin (FK228, depsipeptide) | HDAC1/HDAC2 inhibitor,potent and selective | 128517-07-7 |
| Santacruzamate A (CAY10683) | 1477949-42-0 | |
| SBHA | HDAC1/HDAC3 inhibitor,cell-permeable | 38937-66-5 |
| Scriptaid | HDAC inhibitor,novel and cell-permeable | 287383-59-9 |
| Sodium Phenylbutyrate | Histone deacetylase inhibitor | 1716-12-7 |
| Suberohydroxamic Acid | HDAC inhibitor | 38937-66-5 |
| TC-H 106 | HDAC inhibitor | 937039-45-7 |
| Trichostatin A (TSA) | HDAC inhibitor | 58880-19-6 |
| Tubacin | HDAC6 inhibitor,potent,selective,reversible,cell-permeable | 1350555-93-9 |
| UF 010 | Novel and selective class I HDAC inhibitor | 537672-41-6 |
| Valproic acid | HDAC1 inhibitor | 99-66-1 |
| Valproic acid sodium salt (Sodium valproate) | HDAC inhibitor | 1069-66-5 |
| Vorinostat (SAHA, MK0683) | HDAC inhibitor | 149647-78-9 |
Transcripts for HDAC1 Gene
mRNA/cDNA for HDAC1 Gene
- (2) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (849) Selected AceView cDNA sequences:
- (10) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for HDAC1
-
Santa Cruz Biotechnology (SCBT) CRISPR for HDAC1
- GenScript: Design CRISPR guide RNA sequences for HDAC1
miRNA Products
- Search ViGene Biosciences for HDAC1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
-
ViGene Biosciences ready-to-package AAV shRNAs for HDAC1 gene
Clone Products
-
OriGene ORF clones in human for HDAC1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for HDAC1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for HDAC1
- VectorBuilder custom plasmid, inducible vectors for HDAC1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for HDAC1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-12119) for HDAC1
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6a | · | 6b | · | 6c | ^ | 7 | ^ | 8a | · | 8b | ^ | 9a | · | 9b | · | 9c | · | 9d | ^ | 10a | · | 10b | · | 10c | ^ | 11a | · | 11b | ^ | 12a | · | 12b | · | 12c | ^ | 13 | ^ | 14 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: |
| ExUns: | 15 |
|---|---|
| SP1: | |
| SP2: | |
| SP3: | |
| SP4: | |
| SP5: | |
| SP6: | |
| SP7: | |
| SP8: | |
| SP9: |
Expression for HDAC1 Gene
This gene is overexpressed in Peripheral blood mononuclear cells (12.1) and Lymph node (6.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for HDAC1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of HDAC1 Gene:
HDAC1SOURCE GeneReport for Unigene cluster for HDAC1 Gene:
Hs.88556mRNA Expression by UniProt/SwissProt for HDAC1 Gene:
Q13547-HDAC1_HUMAN
Tissue specificity:
Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.
Evidence on tissue expression from TISSUES for HDAC1 Gene
- Lung(4.8)
- Stomach(4.7)
- Blood(4.6)
- Liver(4.5)
- Intestine(4.2)
- Nervous system(3.7)
- Pancreas(2.8)
- Kidney(2.7)
- Heart(2.4)
- Lymph node(2.4)
- Muscle(2.4)
- Skin(2.4)
- Thyroid gland(2.3)
- Bone marrow(2.2)
- Eye(2.2)
Primer Products
-
OriGene qPCR primer pairs for HDAC1
-
OriGene qPCR primer pairs and template standards for HDAC1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for HDAC1 Gene
Orthologs for HDAC1 Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | HDAC1 34 35 |
|
||
| mouse (Mus musculus) |
Mammalia | Gm10093 35 |
|
OneToMany | |
| Hdac1 34 16 35 |
|
||||
| oppossum (Monodelphis domestica) |
Mammalia | -- 35 |
|
OneToMany | |
| -- 35 |
|
OneToMany | |||
| dog (Canis familiaris) |
Mammalia | HDAC1 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | HDAC1 34 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Hdac1 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | HDAC1 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | HDAC1 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | HDAC1 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | hdac1 34 |
|
||
| Str.6529 34 |
|
||||
| zebrafish (Danio rerio) |
Actinopterygii | hdac1 35 |
|
OneToOne | |
| -- 34 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP006511 34 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | Rpd3 36 34 35 |
|
||
| HDAC3 36 |
|
|
|||
| worm (Caenorhabditis elegans) |
Secernentea | hda-1 36 35 |
|
||
| hda-3 34 35 |
|
||||
| hda-2 36 |
|
|
|||
| A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AGR395W 34 |
|
||
| K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0E01981g 34 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | RPD3 34 35 37 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | HD1 34 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os06g0583400 34 |
|
||
| wheat (Triticum aestivum) |
Liliopsida | Ta.23826 34 |
|
||
| corn (Zea mays) |
Liliopsida | Zm.13633 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.10476 35 |
|
OneToMany | |
| fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | clr6 34 |
|
||
| bread mold (Neurospora crassa) |
Ascomycetes | NCU00824 34 |
|
- Species where no ortholog for HDAC1 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
Paralogs for HDAC1 Gene
(5) SIMAP similar genes for HDAC1 Gene using alignment to 6 proteins:
Pseudogenes.org Pseudogenes for HDAC1 Gene
Variants for HDAC1 Gene
| SNP ID | Clin | Chr 01 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs797044931 | Pathogenic | 32,327,044(+) | CGTCA(A/G)TGATA | reference, missense, utr-variant-5-prime | |
| rs1000005850 | -- | 32,315,064(+) | TTGTA(C/T)TGGTA | intron-variant | |
| rs1000043838 | -- | 32,294,024(+) | ATCTC(-/A)ACCAC | intron-variant | |
| rs1000112357 | -- | 32,322,444(+) | TTGTA(G/T)TTTTA | intron-variant | |
| rs1000164454 | -- | 32,308,468(+) | ACTCC(A/T)AGTGA | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv1122326 | CNV | deletion | 24896259 |
| nsv476322 | CNV | novel sequence insertion | 20440878 |
Residual Variation Intolerance Score:
17.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.58;
65.16% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for HDAC1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for HDAC1 Gene
Disorders for HDAC1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| atrichia with papular lesions |
|
|
| rett syndrome |
|
|
| retinoblastoma |
|
|
| valproate embryopathy, susceptibility to |
|
|
| huntington disease |
|
|
Search HDAC1 in MalaCards
View complete list of genes associated with diseases
Relevant External Links for HDAC1
No data available for UniProtKB/Swiss-Prot and Genatlas for HDAC1 Gene
Publications for HDAC1 Gene
- Chfr is linked to tumour metastasis through the downregulation of HDAC1. (PMID: 19182791) Oh Y.M. … Seol J.H. (Nat. Cell Biol. 2009) 3 4 22 64
- Mechanisms of ceramide-mediated repression of the human telomerase reverse transcriptase promoter via deacetylation of Sp3 by histone deacetylase 1. (PMID: 17548428) Wooten-Blanks L.G. … Ogretmen B. (FASEB J. 2007) 3 4 22 64
- SENP1 enhances androgen receptor-dependent transcription through desumoylation of histone deacetylase 1. (PMID: 15199155) Cheng J. … Yeh E.T.H. (Mol. Cell. Biol. 2004) 3 4 22 64
- Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation. (PMID: 11602581) Pflum M.K.H. … Schreiber S.L. (J. Biol. Chem. 2001) 3 4 22 64
- HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins. (PMID: 10846170) Cai R.L. … Cohen D. (J. Biol. Chem. 2000) 3 4 22 64
Products for HDAC1 Gene
- Browse Small Molecules at EMD Millipore
- EMD Millipore top HDAC1 Antibody
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for HDAC1
- EMD Millipore Purified and/or Recombinant HDAC1 Protein
- EMD Millipore Kits and Assays for HDAC1
- EMD Millipore genomic analysis products
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for HDAC1
- AM20512PU-N
- AM31794PU-N
- AM31795PU-N
- AM31796PU-N
- AM31797PU-N
- AP00270PU-N
- AP06155PU-N
- AP07556PU-N
- AP11121PU-N
- AP15592PU-M
- AP15592PU-N
- AP15592PU-S
- AP20947PU-N
- AP21036PU-N
- AP23098PU-N
- AP32221PU-N
- AP32235PU-N
- TA312923
- TA312924
- TA312925
- TA319251
- TA322691
- TA322692
- TA322693
- TA324515
- TA324609
- TA324678
- TA325167
- TA325506
- TA325507
- TA325508
- TA326790
- TA336336
- TA347134
- TA347135
- TA348969
- TA349072
- TA352611
- TA353865
- TA501999
- CF501999
- TA502028
- CF502028
- TA502142
- CF502142
- TA502143
- CF502143
- TA502193
- CF502193
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for HDAC1
- Search Origene for MassSpec and Protein Over-expression Lysates for HDAC1
- Origene Custom Protein Services for HDAC1
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for HDAC1
- Browse OriGene Inhibitory RNA Products For HDAC1
- OriGene qPCR primer pairs and template standards for HDAC1
- OriGene qPCR primer pairs for HDAC1
- OriGene CRISPR knockouts for HDAC1
- OriGene ORF clones in human for HDAC1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For HDAC1