Aliases for GYS1 Gene
Aliases for GYS1 Gene
External Ids for GYS1 Gene
- HGNC: 4706
- Entrez Gene: 2997
- Ensembl: ENSG00000104812
- OMIM: 138570
- UniProtKB: P13807
Previous HGNC Symbols for GYS1 Gene
- GYS
Previous GeneCards Identifiers for GYS1 Gene
- GC19M050129
- GC19M049839
- GC19M054147
- GC19M054164
- GC19M054165
- GC19M054166
- GC19M049471
- GC19M045849
Summaries for GYS1 Gene
-
The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
GeneCards Summary for GYS1 Gene
GYS1 (Glycogen Synthase 1) is a Protein Coding gene. Diseases associated with GYS1 include Glycogen Storage Disease 0, Muscle and Glycogen Storage Disease. Among its related pathways are Development IGF-1 receptor signaling and Glycogen storage disease type XV (GYG1). GO annotations related to this gene include protein kinase binding and glycogen (starch) synthase activity. An important paralog of this gene is GYS2.
UniProtKB/Swiss-Prot for GYS1 Gene
-
Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GYS1 Gene
Genomics for GYS1 Gene
Regulatory Elements for GYS1 Gene
Enhancers for GYS1 Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH19G048958 | 2.1 | FANTOM5 Ensembl ENCODE dbSUPER | 11.1 | +29.3 | 29324 | 10.2 | MLX CREB3L1 AGO1 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 | PPP1R15A PRR12 NUP62 IZUMO1 RUVBL2 CA11 SEC1P SNORD35B C19orf68 ALDH16A1 |
| GH19G049017 | 1.2 | FANTOM5 ENCODE | 12.9 | -25.2 | -25197 | 2.6 | ATF1 AGO1 SIN3A GLIS2 KLF7 SP3 MXD4 REST KAT8 ZNF592 | RUVBL2 LOC101059948 CGB3 GYS1 CGB7 NTF4 LHB |
| GH19G049020 | 0.8 | FANTOM5 | 12.9 | -27.7 | -27716 | 0.3 | MAZ SP3 KLF1 BHLHE40 SP2 MNT ZNF2 KLF16 ZNF692 ZNF169 | CGB3 GYS1 RUVBL2 CGB7 NTF4 CGB5 LOC101059948 |
| GH19G049021 | 0.5 | ENCODE | 12.9 | -27.2 | -27206 | 0.1 | PKNOX1 RFX1 ZBTB33 PRDM10 | GYS1 RUVBL2 CGB7 NTF4 CGB3 LOC101059948 |
| GH19G048988 | 1.6 | FANTOM5 ENCODE | 0.7 | +1.3 | 1300 | 7.2 | CREB3L1 MLX AGO1 ZFP64 DMAP1 FEZF1 YY1 SLC30A9 ZNF143 ZNF263 | GRWD1 NUP62 PRR12 SNORD35A PIH1D1 KDELR1 AKT1S1 ALDH16A1 SNORD35B LOC101059948 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around GYS1 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for GYS1 Gene
- Chromosome:
- 19
- Start:
- 48,968,125 bp from pter
- End:
- 48,993,353 bp from pter
- Size:
- 25,229 bases
- Orientation:
- Minus strand
Genomic View for GYS1 Gene
Genes around GYS1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 19q13.33 by Ensembl
- 19q13.33 by Entrez Gene
- 19q13.33 by HGNC
GYS1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for GYS1 Gene
Proteins for GYS1 Gene
-
Protein details for GYS1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P13807-GYS1_HUMAN
- Recommended name:
- Glycogen [starch] synthase, muscle
- Protein Accession:
- P13807
- Q9BTT9
Protein attributes for GYS1 Gene
- Size:
- 737 amino acids
- Molecular mass:
- 83786 Da
- Quaternary structure:
-
- Interacts with GYG1.
Protein Expression for GYS1 Gene
Selected DME Specific Peptides for GYS1 Gene
- P13807:
-
- TPNGLNVKKFSA
- TIRRIGLFN
- FPSYYEP
- KFSAMHEFQNLH
- LDKTLYFF
- GRWLIEG
- TNNFNVETLKGQAVRKQLWD
- TTHATLLGR
- IFHPEFL
- HEFQNLHA
- VDFYNNL
- DKEAGERQIYHRYCMERA
- SSLPGLEDWEDEFD
- STPSEPLSP
- EEAAKDRRNIRAPEWPRRASC
- LVGPYTEQGVRTQVELLE
- SVPPSPS
- HPEFLSSTSPLLP
- SYYEPWGYTPAECTVMG
- VLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNY
- QSRRQRII
- TNLSGFGC
- RRQRIIQRNRTERLSDLLDW
- HVFTTVS
- AGRYEFSNKG
Post-translational modifications for GYS1 Gene
- Phosphorylation at Ser-8 by AMPK inactivates the enzyme activity. Primed phosphorylation at Ser-657 (site 5) by CSNK2A1 and CSNK2A2 is required for inhibitory phosphorylation at Ser-641 (site 3a), Ser-645 (site 3b), Ser-649 (site 3c) and Ser-653 (site 4) by GSK3A an GSK3B (By similarity). Phosphorylated at Ser-641 by DYRK2, leading to inactivation (By similarity). Phosphorylated at Ser-641 by PASK, leading to inactivation; phosphorylation by PASK is inhibited by glycogen. Dephosphorylation at Ser-641 and Ser-645 by PP1 activates the enzyme.
- Ubiquitination at posLast=8888, isoforms=2474, and posLast=599599
- Modification sites at PhosphoSitePlus
Other Protein References for GYS1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for GYS1
- Cell Signaling Technology (CST) Antibodies for GYS1 (GYS1)
-
Custom Antibody ServicesOriGene Antibodies for GYS1
- Novus Biologicals Antibodies for GYS1
- Invitrogen Antibodies for GYS1
- antibodies-online Antibodies for GYS1: See all 40
- GeneTex GYS1 antibody for GYS1
Protein Products
-
OriGene Purified Proteins for GYS1
- Search Origene for MassSpec and Protein Over-expression Lysates for GYS1
- Origene Custom Protein Services for GYS1
- antibodies-online Proteins for GYS1: See all 6
- Search antibodies-online for peptides
- Search GeneTex for Proteins for GYS1
Assay Products
- antibodies-online Kits for GYS1: See all 1
Domains & Families for GYS1 Gene
Gene Families for GYS1 Gene
Protein Domains for GYS1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for GYS1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P13807- Family:
-
- Belongs to the glycosyltransferase 3 family.
Function for GYS1 Gene
Molecular function for GYS1 Gene
- GENATLAS Biochemistry:
- glycogen synthase,skeletal muscle,the rate limiting enzyme of the insulin-induced glycogenesis
- UniProtKB/Swiss-Prot CatalyticActivity:
- UDP-alpha-D-glucose + ((1->4)-alpha-D-glucosyl)(n) = UDP + ((1->4)-alpha-D-glucosyl)(n+1).
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Allosteric activation by glucose-6-phosphate. Phosphorylation reduces the activity towards UDP-glucose. When in the non-phosphorylated state, glycogen synthase does not require glucose-6-phosphate as an allosteric activator; when phosphorylated it does (By similarity).
- UniProtKB/Swiss-Prot Function:
- Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Enzyme Numbers (IUBMB) for GYS1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004373 | glycogen (starch) synthase activity | IDA,IEA | 16275910 |
| GO:0005515 | protein binding | IPI | 10481074 |
| GO:0005536 | glucose binding | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
Phenotypes for GYS1 Gene
- MGI mutant phenotypes for GYS1:
- inferred from 4 alleles
- GenomeRNAi human phenotypes for GYS1:
Animal Models for GYS1 Gene
- MGI Knock Outs for GYS1:
-
- Gys1 tm1a(EUCOMM)Wtsi
Animal Model Products
-
Taconic Biosciences Mouse Models for GYS1
-
ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
- Search ViGene Biosciences for GYS1
CRISPR Products
-
OriGene CRISPR knockouts for GYS1
-
Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
miRNA for GYS1 Gene
- miRTarBase miRNAs that target GYS1
-
- hsa-let-7b-5p (MIRT001626)
- hsa-mir-122-5p (MIRT003080)
- hsa-mir-26b-5p (MIRT028992)
- hsa-mir-516b-5p (MIRT718488)
- hsa-mir-3191-5p (MIRT718489)
- hsa-mir-6873-3p (MIRT718490)
- hsa-mir-7111-3p (MIRT718491)
- hsa-mir-6081 (MIRT718492)
- hsa-mir-324-5p (MIRT718493)
- hsa-mir-20a-3p (MIRT718494)
- hsa-mir-6824-3p (MIRT718495)
- hsa-mir-6764-3p (MIRT718496)
- hsa-mir-330-5p (MIRT718497)
- hsa-mir-326 (MIRT718498)
- hsa-mir-518c-5p (MIRT718499)
- hsa-mir-6817-3p (MIRT718500)
- hsa-mir-7110-3p (MIRT718501)
- hsa-mir-6769b-3p (MIRT718502)
- hsa-mir-4723-3p (MIRT718503)
- hsa-mir-3183 (MIRT718504)
- hsa-mir-2276-5p (MIRT718505)
- hsa-mir-5196-3p (MIRT718506)
- hsa-mir-27a-3p (MIRT727518)
- hsa-mir-27b-3p (MIRT727519)
miRNA Products
- Search ViGene Biosciences for GYS1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
Clone Products
- Sino Biological Human cDNA Clone for GYS1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for GYS1
Cell Line Products
-
Horizon Cell Lines for GYS1
-
ViGene Biosciences adenoviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
Flow Cytometry Products
No data available for Transcription Factor Targets and HOMER Transcription for GYS1 Gene
Localization for GYS1 Gene
| Compartment | Confidence |
|---|---|
| cytosol | 5 |
| nucleus | 3 |
| cytoskeleton | 2 |
| mitochondrion | 1 |
| peroxisome | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0016020 | membrane | IDA | 19946888 |
| GO:0016234 | inclusion body | IEA | -- |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for GYS1 Gene
Pathways & Interactions for GYS1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Activation of cAMP-Dependent PKA |
.77
|
.56
|
| 2 | Glucose metabolism | ||
| 3 | Galactose metabolism | ||
| 4 | Myoclonic epilepsy of Lafora | ||
| 5 | AMP-activated Protein Kinase (AMPK) Signaling | ||
Pathways by source for GYS1 Gene
1 Sino Biological pathway for GYS1 Gene
1 Cell Signaling Technology pathway for GYS1 Gene
6 BioSystems pathways for GYS1 Gene
12 Reactome pathways for GYS1 Gene
7 KEGG pathways for GYS1 Gene
4 GeneGo (Thomson Reuters) pathways for GYS1 Gene
1 R&D Systems pathway for GYS1 Gene
10 Qiagen pathways for GYS1 Gene
UniProtKB/Swiss-Prot P13807-GYS1_HUMAN
- Pathway: Glycan biosynthesis; glycogen biosynthesis.
Interacting Proteins for GYS1 Gene
Selected Interacting proteins:
P13807-GYS1_HUMAN
ENSP00000317904
for GYS1 Gene via
MINT
STRING
IID
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005977 | glycogen metabolic process | IEA | -- |
| GO:0005978 | glycogen biosynthetic process | TAS,IEA | -- |
| GO:0007507 | heart development | IEA | -- |
| GO:0008152 | metabolic process | IEA | -- |
Drugs & Compounds for GYS1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| amylose |
|
9005-82-7 |
|
Transcripts for GYS1 Gene
mRNA/cDNA for GYS1 Gene
- (2) REFSEQ mRNAs :
- (12) Additional mRNA sequences :
- (307) Selected AceView cDNA sequences:
- (7) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for GYS1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for GYS1
-
Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
miRNA Products
- Search ViGene Biosciences for GYS1
Inhibitory RNA Products
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
Clone Products
- Sino Biological Human cDNA Clone for GYS1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for GYS1
Flow Cytometry Products
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | |||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||||||||||||||||
| SP4: |
Expression for GYS1 Gene
mRNA differential expression in normal tissues according to GTEx for GYS1 Gene
This gene is overexpressed in Muscle - Skeletal (x8.2) and Heart - Left Ventricle (x5.2).
This gene is overexpressed in Heart (22.2) and Fetal heart (8.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GYS1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of GYS1 Gene:
GYS1SOURCE GeneReport for Unigene cluster for GYS1 Gene:
Hs.386225Evidence on tissue expression from TISSUES for GYS1 Gene
- Muscle(4.8)
- Nervous system(4.7)
- Liver(4.5)
- Skin(4.5)
- Kidney(4.3)
- Lung(2.8)
- Heart(2.7)
Phenotype-based relationships between genes and organs from Gene ORGANizer for GYS1 Gene
Germ Layers:
- ectoderm
- mesoderm
Systems:
- cardiovascular
- nervous
- skeletal muscle
Organs:
Head and neck:
- brain
- ear
- head
Thorax:
- heart
- heart valve
Primer Products
-
OriGene qPCR primer pairs for GYS1
-
OriGene qPCR primer pairs and template standards for GYS1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA Expression by UniProt/SwissProt for GYS1 Gene
Orthologs for GYS1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | GYS1 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | GYS1 35 34 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | GYS1 34 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | GYS1 35 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Gys1 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Gys1 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | GYS1 35 |
|
OneToOne | |
| lizard (Anolis carolinensis) |
Reptilia | GYS1 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | LOC100490155 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | gys1 34 35 |
|
||
| -- 34 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | CG6904 36 34 35 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002586 34 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | gsy-1 34 35 |
|
||
| Y46G5A.31 36 |
|
|
|||
| A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AAR008W 34 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | GSY1 34 35 37 |
|
||
| K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0F23133g 34 |
|
||
| bread mold (Neurospora crassa) |
Ascomycetes | NCU06687 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
OneToMany |
- Species where no ortholog for GYS1 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for GYS1 Gene
(1) SIMAP similar genes for GYS1 Gene using alignment to 5 proteins:
Variants for GYS1 Gene
| SNP ID | Clin | Chr 19 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs121434584 | Pathogenic | 48,974,658(-) | TCCGC(C/T)GAATC | nc-transcript-variant, reference, stop-gained | |
| rs587777375 | Pathogenic | 48,991,439(+) | GTCCC(-/CT)GTCAC | intron-variant, reference, frameshift-variant | |
| rs1042265 | Likely benign | 48,968,563(-) | TCTGG(C/T)CCTTT | nc-transcript-variant, utr-variant-3-prime | |
| rs117997270 | Likely benign | 48,968,380(+) | AGTAA(C/T)GTGGT | nc-transcript-variant, utr-variant-3-prime | |
| rs142265031 | Likely benign | 48,969,459(+) | TTGGC(A/G)GCCTC | nc-transcript-variant, reference, synonymous-codon |
Residual Variation Intolerance Score:
9.48% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.46;
54.93% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for GYS1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GYS1 Gene
Disorders for GYS1 Gene
(9) MalaCards diseases for GYS1 Gene - From: OMIM, ClinVar, GeneTests, Orphanet, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| glycogen storage disease 0, muscle |
|
|
| glycogen storage disease |
|
|
| glycogen storage disease type 0 |
|
|
| brain germinoma |
|
|
| cystic angiomatosis of bone, diffuse |
|
|
Search GYS1 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
GYS1_HUMAN- Muscle glycogen storage disease 0 (GSD0b) [MIM:611556]: Metabolic disorder characterized by fasting hypoglycemia presenting in infancy or early childhood. The role of muscle glycogen is to provide critical energy during bursts of activity and sustained muscle work. {ECO:0000269 PubMed:17928598}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Relevant External Links for GYS1
No data available for Genatlas for GYS1 Gene
Publications for GYS1 Gene
- Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone. (PMID: 18996102) RuaA+o G. … Hanks S. (Clin. Chim. Acta 2009) 3 22 46 64
- Variation in GYS1 interacts with exercise and gender to predict cardiovascular mortality. (PMID: 17356695) Fredriksson J. … Orho-Melander M. (PLoS ONE 2007) 3 22 46 64
- Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension. (PMID: 17137217) Kokubo Y. … Miyata T. (Hypertens. Res. 2006) 3 22 46 64
- Association of muscle glycogen synthase polymorphism with insulin resistance in type 2 diabetic patients. (PMID: 12870167) Motoyama K. … Nishizawa Y. (Metab. Clin. Exp. 2003) 3 22 46 64
- Association of GYS1 and beta(3)-AR gene with postprandial hyperglycemia and serum uric acid in type 2 diabetes mellitus. (PMID: 12411100) Wang G. … Xu X. (Chin. Med. J. 2002) 3 22 46 64
Products for GYS1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for GYS1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for GYS1
- Search Origene for MassSpec and Protein Over-expression Lysates for GYS1
- Origene Custom Protein Services for GYS1
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
- OriGene qPCR primer pairs and template standards for GYS1
- OriGene qPCR primer pairs for GYS1
- OriGene CRISPR knockouts for GYS1
- OriGene ORF clones in human for GYS1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For GYS1
- GenScript: Next-day shipping cDNA ORF clone for GYS1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for GYS1
- GenScript Custom Assay Services for GYS1
- GenScript Custom overexpressing Cell Line Services for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for GYS1
- Cell Signaling Technology (CST) Antibodies for GYS1 (GYS1)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for GYS1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for GYS1
- Novus Biologicals proteins and lysates for GYS1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Taconic Biosciences Mouse Models for GYS1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Addgene plasmids for GYS1
- antibodies-online Antibodies for GYS1: See all 40
- antibodies-online Kits for GYS1: See all 1
- antibodies-online Proteins for GYS1: See all 6
- Search antibodies-online for peptides
- GeneTex GYS1 antibody for GYS1
- Search GeneTex for Proteins for GYS1
- ViGene Biosciences adenoviral particle packaged cDNA for GYS1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
- Search ViGene Biosciences for GYS1
- Search Santa Cruz Biotechnology (SCBT) for GYS1 Antibodies
- Search Santa Cruz Biotechnology (SCBT) for GYS1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- Horizon Cell Lines for GYS1
- Cyagen custom Knockout/knockin (KOKI) mouse models for GYS1
- VectorBuilder custom plasmid, inducible vectors for GYS1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for GYS1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for GYS1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer