Aliases for GYS1 Gene
Aliases for GYS1 Gene
External Ids for GYS1 Gene
- HGNC: 4706
- Entrez Gene: 2997
- Ensembl: ENSG00000104812
- OMIM: 138570
- UniProtKB: P13807
Previous HGNC Symbols for GYS1 Gene
- GYS
Previous GeneCards Identifiers for GYS1 Gene
- GC19M050129
- GC19M049839
- GC19M054147
- GC19M054164
- GC19M054165
- GC19M054166
- GC19M049471
- GC19M045849
Summaries for GYS1 Gene
-
The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
GeneCards Summary for GYS1 Gene
GYS1 (Glycogen Synthase 1) is a Protein Coding gene. Diseases associated with GYS1 include Glycogen Storage Disease 0, Muscle and Glycogen Storage Disease. Among its related pathways are NFAT and Cardiac Hypertrophy and Glycogen storage diseases. Gene Ontology (GO) annotations related to this gene include protein kinase binding and glycogen (starch) synthase activity. An important paralog of this gene is GYS2.
UniProtKB/Swiss-Prot for GYS1 Gene
-
Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Additional gene information for GYS1 Gene
- Monarch Initiative
- Search for GYS1 at DataMed
- Search for GYS1 at HumanCyc
No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GYS1 Gene
Genomics for GYS1 Gene
GeneHancer (GH) Regulatory Elements for GYS1 Gene
Regulatory Element Products
Genomic Locations for GYS1 Gene
- chr19:48,968,125-48,993,353
- (GRCh38/hg38)
- Size:
- 25,229 bases
- Orientation:
- Minus strand
- chr19:49,471,382-49,496,610
- (GRCh37/hg19)
Genomic View for GYS1 Gene
- Cytogenetic band:
-
- 19q13.33 by Ensembl
- 19q13.33 by Entrez Gene
- 19q13.33 by HGNC


RefSeq DNA sequence for GYS1 Gene
Proteins for GYS1 Gene
-
Protein details for GYS1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P13807-GYS1_HUMAN
- Recommended name:
- Glycogen [starch] synthase, muscle
- Protein Accession:
- P13807
- Q9BTT9
Protein attributes for GYS1 Gene
- Size:
- 737 amino acids
- Molecular mass:
- 83786 Da
- Quaternary structure:
-
- Interacts with GYG1.
Protein Expression for GYS1 Gene
Selected DME Specific Peptides for GYS1 Gene
- P13807:
-
- TPNGLNVKKFSA
- TIRRIGLFN
- FPSYYEP
- KFSAMHEFQNLH
- LDKTLYFF
- GRWLIEG
- TNNFNVETLKGQAVRKQLWD
- TTHATLLGR
- IFHPEFL
- HEFQNLHA
- VDFYNNL
- DKEAGERQIYHRYCMERA
- SSLPGLEDWEDEFD
- STPSEPLSP
- EEAAKDRRNIRAPEWPRRASC
- LVGPYTEQGVRTQVELLE
- SVPPSPS
- HPEFLSSTSPLLP
- SYYEPWGYTPAECTVMG
- VLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNY
- QSRRQRII
- TNLSGFGC
- RRQRIIQRNRTERLSDLLDW
- HVFTTVS
- AGRYEFSNKG
Post-translational modifications for GYS1 Gene
- Phosphorylation at Ser-8 by AMPK inactivates the enzyme activity. Primed phosphorylation at Ser-657 (site 5) by CSNK2A1 and CSNK2A2 is required for inhibitory phosphorylation at Ser-641 (site 3a), Ser-645 (site 3b), Ser-649 (site 3c) and Ser-653 (site 4) by GSK3A an GSK3B (By similarity). Phosphorylated at Ser-641 by DYRK2, leading to inactivation (By similarity). Phosphorylated at Ser-641 by PASK, leading to inactivation; phosphorylation by PASK is inhibited by glycogen. Dephosphorylation at Ser-641 and Ser-645 by PP1 activates the enzyme.
- Ubiquitination at posLast=8888, posLast=474474, and isoforms=2599
Other Protein References for GYS1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for GYS1 (GYS1)
-
Custom Antibody ServicesOriGene Antibodies for GYS1
- Novus Biologicals Antibodies for GYS1
-
Abcam antibodies for GYS1
- Invitrogen Antibodies for GYS1
- GeneTex GYS1 antibody for GYS1
Protein Products
-
OriGene Purified Proteins for GYS1
- Search Origene for MassSpec and Protein Over-expression Lysates for GYS1
- Origene Custom Protein Services for GYS1
- Search GeneTex for Proteins for GYS1
-
Abcam proteins for GYS1
Assay Products
-
Abcam assays for GYS1
Domains & Families for GYS1 Gene
Gene Families for GYS1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Plasma proteins
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for GYS1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for GYS1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P13807- Family:
-
- Belongs to the glycosyltransferase 3 family.
Function for GYS1 Gene
Molecular function for GYS1 Gene
- GENATLAS Biochemistry:
- glycogen synthase,skeletal muscle,the rate limiting enzyme of the insulin-induced glycogenesis
- UniProtKB/Swiss-Prot CatalyticActivity:
- UDP-alpha-D-glucose + ((1->4)-alpha-D-glucosyl)(n) = UDP + ((1->4)-alpha-D-glucosyl)(n+1).
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Allosteric activation by glucose-6-phosphate. Phosphorylation reduces the activity towards UDP-glucose. When in the non-phosphorylated state, glycogen synthase does not require glucose-6-phosphate as an allosteric activator; when phosphorylated it does (By similarity).
- UniProtKB/Swiss-Prot Function:
- Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Enzyme Numbers (IUBMB) for GYS1 Gene
Phenotypes From GWAS Catalog for GYS1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004373 | glycogen (starch) synthase activity | IDA,IEA | 16275910 |
GO:0005515 | protein binding | IPI | 10481074 |
GO:0005536 | glucose binding | IEA | -- |
GO:0016740 | transferase activity | IEA | -- |
GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
Phenotypes for GYS1 Gene
- MGI mutant phenotypes for GYS1:
- inferred from 4 alleles
- GenomeRNAi human phenotypes for GYS1:
Animal Models for GYS1 Gene
- MGI Knock Outs for GYS1:
-
- Gys1 tm1a(EUCOMM)Wtsi
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
- Search ViGene Biosciences for GYS1
CRISPR Products
-
OriGene CRISPR knockouts for GYS1
- Applied Biological Materials CRISPR for GYS1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
miRNA for GYS1 Gene
- miRTarBase miRNAs that target GYS1
-
- hsa-let-7b-5p (MIRT001626)
- hsa-mir-122-5p (MIRT003080)
- hsa-mir-26b-5p (MIRT028992)
- hsa-mir-516b-5p (MIRT718488)
- hsa-mir-3191-5p (MIRT718489)
- hsa-mir-6873-3p (MIRT718490)
- hsa-mir-7111-3p (MIRT718491)
- hsa-mir-6081 (MIRT718492)
- hsa-mir-324-5p (MIRT718493)
- hsa-mir-20a-3p (MIRT718494)
- hsa-mir-6824-3p (MIRT718495)
- hsa-mir-6764-3p (MIRT718496)
- hsa-mir-330-5p (MIRT718497)
- hsa-mir-326 (MIRT718498)
- hsa-mir-518c-5p (MIRT718499)
- hsa-mir-6817-3p (MIRT718500)
- hsa-mir-7110-3p (MIRT718501)
- hsa-mir-6769b-3p (MIRT718502)
- hsa-mir-4723-3p (MIRT718503)
- hsa-mir-3183 (MIRT718504)
- hsa-mir-2276-5p (MIRT718505)
- hsa-mir-5196-3p (MIRT718506)
- hsa-mir-27a-3p (MIRT727518)
- hsa-mir-27b-3p (MIRT727519)
miRNA Products
- Search ViGene Biosciences for GYS1
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
Clone Products
- Sino Biological Human cDNA Clone for GYS1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for GYS1
- genomics-online: cdna clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- orf clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- Applied Biological Materials Clones for GYS1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for GYS1
-
ViGene Biosciences adenoviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
No data available for Transcription Factor Targets and HOMER Transcription for GYS1 Gene
Localization for GYS1 Gene
- Cytosol (2)
- Microtubules (2)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005737 | cytoplasm | IEA | -- |
GO:0005829 | cytosol | TAS | -- |
GO:0016020 | membrane | HDA,IDA | 19946888 |
GO:0016234 | inclusion body | IEA | -- |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for GYS1 Gene
Pathways & Interactions for GYS1 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Activation of cAMP-Dependent PKA |
.77
|
.56
|
2 | Glucose metabolism | ||
3 | Galactose metabolism | ||
4 | Glycogen storage diseases | ||
5 | AMP-activated Protein Kinase (AMPK) Signaling |
Pathways by source for GYS1 Gene
1 Sino Biological pathway for GYS1 Gene
1 Cell Signaling Technology pathway for GYS1 Gene
6 BioSystems pathways for GYS1 Gene
12 Reactome pathways for GYS1 Gene
7 KEGG pathways for GYS1 Gene
4 GeneGo (Thomson Reuters) pathways for GYS1 Gene
1 R&D Systems pathway for GYS1 Gene
10 Qiagen pathways for GYS1 Gene
UniProtKB/Swiss-Prot P13807-GYS1_HUMAN
- Pathway: Glycan biosynthesis; glycogen biosynthesis.
Interacting Proteins for GYS1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005977 | glycogen metabolic process | IEA | -- |
GO:0005978 | glycogen biosynthetic process | TAS,IEA | -- |
GO:0007507 | heart development | IEA | -- |
GO:0008152 | metabolic process | IEA | -- |
Drugs & Compounds for GYS1 Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
amylose |
|
9005-82-7 |
|
Transcripts for GYS1 Gene
mRNA/cDNA for GYS1 Gene
- (2) REFSEQ mRNAs :
- (12) Additional mRNA sequences :
- (307) Selected AceView cDNA sequences:
- (7) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for GYS1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for GYS1
- Applied Biological Materials CRISPR for GYS1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
miRNA Products
- Search ViGene Biosciences for GYS1
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
-
ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
Clone Products
- Sino Biological Human cDNA Clone for GYS1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for GYS1
- genomics-online: cdna clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- orf clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- Applied Biological Materials Clones for GYS1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | |||||||||||||||||||||||||||||||||||||
SP2: | - | - | - | ||||||||||||||||||||||||||||||||||||
SP3: | |||||||||||||||||||||||||||||||||||||||
SP4: |
Expression for GYS1 Gene
mRNA differential expression in normal tissues according to GTEx for GYS1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GYS1 Gene
NURSA nuclear receptor signaling pathways regulating expression of GYS1 Gene:
GYS1SOURCE GeneReport for Unigene cluster for GYS1 Gene:
Hs.386225Evidence on tissue expression from TISSUES for GYS1 Gene
- Muscle(4.8)
- Nervous system(4.7)
- Liver(4.5)
- Skin(4.5)
- Kidney(4.3)
- Lung(2.8)
- Heart(2.7)
Phenotype-based relationships between genes and organs from Gene ORGANizer for GYS1 Gene
- ectoderm
- mesoderm
- cardiovascular
- nervous
- skeletal muscle
- brain
- ear
- head
- heart
- heart valve
Primer Products
-
OriGene qPCR primer pairs and template standards for GYS1
-
OriGene qPCR primer pairs for GYS1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA Expression by UniProt/SwissProt for GYS1 Gene
Orthologs for GYS1 Gene
This gene was present in the common ancestor of animals and fungi.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | GYS1 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | GYS1 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | GYS1 33 34 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | GYS1 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Gys1 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Gys1 33 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | GYS1 34 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | GYS1 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | LOC100490155 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | gys1 33 34 |
|
||
-- 33 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | CG6904 35 33 34 |
|
||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002586 33 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | gsy-1 33 34 |
|
||
Y46G5A.31 35 |
|
|
|||
A. gosspyii yeast (Ashbya gossypii) |
Saccharomycetes | AGOS_AAR008W 33 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | GSY1 33 34 |
|
||
GSY2 36 |
|
|
|||
K. lactis yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0F23133g 33 |
|
||
bread mold (Neurospora crassa) |
Ascomycetes | NCU06687 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany |
- Species where no ortholog for GYS1 was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- chicken (Gallus gallus)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for GYS1 Gene
(1) SIMAP similar genes for GYS1 Gene using alignment to 5 proteins:
Variants for GYS1 Gene
SNP ID | Clin | Chr 19 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1042265 | benign, likely-benign, Neuroferritinopathy, Glycogen storage disease 0, muscle, Hyperferritinemia cataract syndrome | 48,968,563(-) | G/A | 3_prime_UTR_variant, non_coding_transcript_variant | |
rs117997270 | likely-benign, Hyperferritinemia cataract syndrome, Glycogen storage disease 0, muscle, Neuroferritinopathy | 48,968,380(-) | C/T | 3_prime_UTR_variant, non_coding_transcript_variant | |
rs121434584 | pathogenic, Glycogen storage disease 0, muscle | 48,974,658(-) | G/A | coding_sequence_variant, non_coding_transcript_variant, stop_gained | |
rs138330298 | uncertain-significance, Glycogen storage disease 0, muscle | 48,985,972(-) | C/T | coding_sequence_variant, missense_variant, non_coding_transcript_variant | |
rs142265031 | likely-benign, Neuroferritinopathy, Hyperferritinemia cataract syndrome, not specified | 48,969,459(-) | G/A | coding_sequence_variant, non_coding_transcript_variant, synonymous_variant |
Additional Variant Information for GYS1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GYS1 Gene
Disorders for GYS1 Gene

(8) MalaCards diseases for GYS1 Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
glycogen storage disease 0, muscle |
|
|
glycogen storage disease |
|
|
fasting hypoglycemia |
|
|
glycogen storage disease type 0 |
|
|
brain germinoma |
|
|
UniProtKB/Swiss-Prot
GYS1_HUMAN- Muscle glycogen storage disease 0 (GSD0b) [MIM:611556]: Metabolic disorder characterized by fasting hypoglycemia presenting in infancy or early childhood. The role of muscle glycogen is to provide critical energy during bursts of activity and sustained muscle work. {ECO:0000269 PubMed:17928598}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for GYS1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for GYS1 Gene
Publications for GYS1 Gene
- Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone. (PMID: 18996102) Ruaño G … Hanks S (Clinica chimica acta; international journal of clinical chemistry 2009) 3 22 44 58
- Variation in GYS1 interacts with exercise and gender to predict cardiovascular mortality. (PMID: 17356695) Fredriksson J … Botnia Study Group (PloS one 2007) 3 22 44 58
- Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension. (PMID: 17137217) Kokubo Y … Miyata T (Hypertension research : official journal of the Japanese Society of Hypertension 2006) 3 22 44 58
- Association of muscle glycogen synthase polymorphism with insulin resistance in type 2 diabetic patients. (PMID: 12870167) Motoyama K … Nishizawa Y (Metabolism: clinical and experimental 2003) 3 22 44 58
- Association of GYS1 and beta(3)-AR gene with postprandial hyperglycemia and serum uric acid in type 2 diabetes mellitus. (PMID: 12411100) Wang G … Xu X (Chinese medical journal 2002) 3 22 44 58
Products for GYS1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for GYS1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for GYS1
- Search Origene for MassSpec and Protein Over-expression Lysates for GYS1
- Origene Custom Protein Services for GYS1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for GYS1
- Browse OriGene Inhibitory RNA Products For GYS1
- OriGene qPCR primer pairs and template standards for GYS1
- OriGene qPCR primer pairs for GYS1
- OriGene CRISPR knockouts for GYS1
- OriGene ORF clones in human for GYS1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For GYS1
- GenScript: Next-day shipping of latest version cDNA ORF clones for GYS1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for GYS1
- GenScript Custom Assay Services for GYS1
- GenScript Custom overexpressing Cell Line Services for GYS1
- GenScript: Design CRISPR guide RNA sequences for GYS1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for GYS1
- Cell Signaling Technology (CST) Antibodies for GYS1 (GYS1)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for GYS1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for GYS1
- Novus Biologicals lysates and proteins for GYS1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for GYS1
- Abcam proteins for GYS1
- Abcam assays for GYS1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for GYS1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for GYS1
- antibodies-online: Search results for 58 available Glycogen Synthase 1 Antibodies ranked by validation data
- Compare Top Glycogen Synthase 1 Antibodies
- antibodies-online: Search results for 3 available Glycogen Synthase 1 Elisa Kits ranked by validation data
- Compare Top Glycogen Synthase 1 Elisa Kits
- antibodies-online: Search results for 5 available Glycogen Synthase 1 Proteins ranked by validation data
- Compare Top Glycogen Synthase 1 Proteins
- GeneTex GYS1 antibody for GYS1
- Search GeneTex for Proteins for GYS1
- ViGene Biosciences adenoviral particle packaged cDNA for GYS1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for GYS1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for GYS1 gene
- Search ViGene Biosciences for GYS1
- Browse Santa Cruz Biotechnology (SCBT) Antibodies
- Search Santa Cruz Biotechnology (SCBT) for GYS1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for GYS1
- Horizon Cell Lines for GYS1
- genomics-online: cdna clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- orf clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- genomics-online: gRNA clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- genomics-online: primer clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
- genomics-online: shRNA clones - Search results for 126 available Glycogen Synthase 1 gene related products
- Overview of 126 available Glycogen Synthase 1 gene related products
Sources for GYS1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew