Free for academic non-profit institutions. Other users need a Commercial license

Aliases for GPAM Gene

Aliases for GPAM Gene

  • Glycerol-3-Phosphate Acyltransferase, Mitochondrial 2 3 5
  • Glycerol-3-Phosphate Acyltransferase 1, Mitochondrial 2 3
  • EC 2.3.1.15 4 61
  • GPAT-1 3 4
  • GPAT1 3 4
  • KIAA1560 4
  • EC 2.3.1 61
  • GPAT 3

External Ids for GPAM Gene

Previous GeneCards Identifiers for GPAM Gene

  • GC10U990097
  • GC10M113575
  • GC10M113899
  • GC10M107537

Summaries for GPAM Gene

Entrez Gene Summary for GPAM Gene

  • This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathway's first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

GeneCards Summary for GPAM Gene

GPAM (Glycerol-3-Phosphate Acyltransferase, Mitochondrial) is a Protein Coding gene. Among its related pathways are Metabolism and Acyl chain remodelling of PE. GO annotations related to this gene include transferase activity, transferring acyl groups and glycerol-3-phosphate O-acyltransferase activity. An important paralog of this gene is GPAT2.

UniProtKB/Swiss-Prot for GPAM Gene

  • Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.

Gene Wiki entry for GPAM Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GPAM Gene

Genomics for GPAM Gene

Regulatory Elements for GPAM Gene

Enhancers for GPAM Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10F112222 0.4 ENCODE 8.4 -8.8 -8822 3.1 ELF3 PKNOX1 ZNF48 RAD21 RARA YY1 SCRT2 CREM PAF1 PPARG GPAM TECTB LOC101927600
GH10F112264 0.2 ENCODE 5.4 -50.2 -50156 2.3 PKNOX1 ARNT MLX YY1 ZNF766 JUNB PPARG TBX21 MEF2D SSRP1 TECTB GPAM LOC101927600
GH10F112274 1.1 FANTOM5 ENCODE 4.5 -60.3 -60322 1.6 ZFP64 ARID4B DMAP1 YY1 SP5 PPARG KAT8 MIER3 ATF4 RCOR2 TECTB GPAM LOC101927600
GH10F112259 0.2 ENCODE 4.3 -45.9 -45856 2.6 ATF1 MLX ZFP64 ARID4B DMAP1 ZNF48 YY1 SLC30A9 SP5 NFYC TECTB GPAM LOC101927600
GH10F112626 0.3 FANTOM5 1.5 -410.7 -410685 0.0 TECTB GPAM MIR4295 GC10M112255
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around GPAM on UCSC Golden Path with GeneCards custom track

Genomic Location for GPAM Gene

Chromosome:
10
Start:
112,149,864 bp from pter
End:
112,215,395 bp from pter
Size:
65,532 bases
Orientation:
Minus strand

Genomic View for GPAM Gene

Genes around GPAM on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GPAM Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GPAM Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GPAM Gene

Proteins for GPAM Gene

  • Protein details for GPAM Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HCL2-GPAT1_HUMAN
    Recommended name:
    Glycerol-3-phosphate acyltransferase 1, mitochondrial
    Protein Accession:
    Q9HCL2
    Secondary Accessions:
    • Q5VW51
    • Q86TA3

    Protein attributes for GPAM Gene

    Size:
    828 amino acids
    Molecular mass:
    93795 Da
    Quaternary structure:
    No Data Available

neXtProt entry for GPAM Gene

Selected DME Specific Peptides for GPAM Gene

Q9HCL2:
  • KAASLCYLLSNEGTISLPCQTFYQ
  • VAVYAESATYCLVKNAVK
  • RPFVGRCC
  • TLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQ
  • HRSHIDY
  • GISYDRIIEGHYNGEQLGKPKKNESLWS
  • GTIDVSYLP
  • FLEGTRSR
  • LAEHILFTASKSCAIMSTHIVACLLLYRHRQGI

Post-translational modifications for GPAM Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for GPAM Gene

Antibody Products

  • Santa Cruz Biotechnology (SCBT) Antibodies for GPAM

Domains & Families for GPAM Gene

Gene Families for GPAM Gene

Suggested Antigen Peptide Sequences for GPAM Gene

Graphical View of Domain Structure for InterPro Entry

Q9HCL2

UniProtKB/Swiss-Prot:

GPAT1_HUMAN :
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Belongs to the GPAT/DAPAT family.
Domain:
  • The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Family:
  • Belongs to the GPAT/DAPAT family.
genes like me logo Genes that share domains with GPAM: view

Function for GPAM Gene

Molecular function for GPAM Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1-acyl-sn-glycerol 3-phosphate.
UniProtKB/Swiss-Prot Function:
Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.

Enzyme Numbers (IUBMB) for GPAM Gene

Gene Ontology (GO) - Molecular Function for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004366 glycerol-3-phosphate O-acyltransferase activity IMP 18238778
GO:0008374 O-acyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with GPAM: view
genes like me logo Genes that share phenotypes with GPAM: view

Animal Models for GPAM Gene

MGI Knock Outs for GPAM:

Animal Model Products

  • Taconic Biosciences Mouse Models for GPAM

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for GPAM Gene

Localization for GPAM Gene

Subcellular locations from UniProtKB/Swiss-Prot for GPAM Gene

Mitochondrion outer membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for GPAM Gene COMPARTMENTS Subcellular localization image for GPAM gene
Compartment Confidence
mitochondrion 5
cytosol 2
endoplasmic reticulum 2
plasma membrane 2
nucleus 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane TAS --
GO:0005743 mitochondrial inner membrane IEA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with GPAM: view

Pathways & Interactions for GPAM Gene

genes like me logo Genes that share pathways with GPAM: view

UniProtKB/Swiss-Prot Q9HCL2-GPAT1_HUMAN

  • Pathway: Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.

Gene Ontology (GO) - Biological Process for GPAM Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IEA --
GO:0006637 acyl-CoA metabolic process IEA --
GO:0006641 triglyceride metabolic process IEA --
GO:0006650 glycerophospholipid metabolic process IEA --
genes like me logo Genes that share ontologies with GPAM: view

No data available for SIGNOR curated interactions for GPAM Gene

Drugs & Compounds for GPAM Gene

(4) Drugs for GPAM Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Propionyl-CoA Experimental Pharma 0
Coenzyme A Nutra 0

(41) Additional Compounds for GPAM Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
acetyl-coa
  • Ac-CoA
  • Ac-Coenzyme A
  • Ac-S-CoA
  • Ac-S-Coenzyme A
  • Acetyl coenzyme-A
72-89-9
glycerol 3-phosphate
  • 1-(Dihydrogen phosphate) Glycerol
  • 1-Glycerophosphate
  • 1-Glycerophosphorate
  • 1-Glycerophosphoric acid
  • 3-Glycerophosphate
57-03-4
(2E)-Decenoyl-CoA
  • (E)-S-2-decenoate
  • (E)-S-2-decenoate CoA
  • (E)-S-2-decenoate Coenzyme A
  • (E)-S-2-decenoic acid
  • 2-trans-Decenoyl-CoA
10018-95-8
(2E)-Dodecenoyl-CoA
  • (2E)-Dodec-2-enoyl-CoA
  • (2E)-Dodec-2-enoyl-Coenzyme A
  • 2-trans-Dodecenoyl-CoA
  • 2-trans-Dodecenoyl-Coenzyme A
1066-12-2
(2E)-Hexadecenoyl-CoA
  • (2E)-Hexadecenoyl-CoA
  • (2E)-Hexadecenoyl-Coenzyme A
  • trans-2-Hexadecenoyl-CoA
  • trans-2-Hexadecenoyl-Coenzyme A
4460-95-1
genes like me logo Genes that share compounds with GPAM: view

Transcripts for GPAM Gene

Unigene Clusters for GPAM Gene

Glycerol-3-phosphate acyltransferase, mitochondrial:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for GPAM Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^
SP1: - - - -
SP2: - - -
SP3: - -
SP4:
SP5:
SP6: -

ExUns: 21 ^ 22a · 22b ^ 23 ^ 24
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for GPAM Gene

GeneLoc Exon Structure for
GPAM
ECgene alternative splicing isoforms for
GPAM

Expression for GPAM Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for GPAM Gene

mRNA differential expression in normal tissues according to GTEx for GPAM Gene

This gene is overexpressed in Adipose - Visceral (Omentum) (x11.7), Adipose - Subcutaneous (x9.2), Breast - Mammary Tissue (x5.4), and Liver (x5.1).

Protein differential expression in normal tissues from HIPED for GPAM Gene

This gene is overexpressed in Gallbladder (22.0), Breast (12.9), Liver (12.1), and Adipocyte (8.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GPAM Gene



NURSA nuclear receptor signaling pathways regulating expression of GPAM Gene:

GPAM

SOURCE GeneReport for Unigene cluster for GPAM Gene:

Hs.42586
genes like me logo Genes that share expression patterns with GPAM: view

Primer Products

No data available for Protein tissue co-expression partners and mRNA Expression by UniProt/SwissProt for GPAM Gene

Orthologs for GPAM Gene

This gene was present in the common ancestor of animals.

Orthologs for GPAM Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GPAM 34 35
  • 99.6 (n)
dog
(Canis familiaris)
Mammalia GPAM 34 35
  • 91.02 (n)
cow
(Bos Taurus)
Mammalia GPAM 34 35
  • 89.49 (n)
oppossum
(Monodelphis domestica)
Mammalia GPAM 35
  • 89 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GPAM 35
  • 86 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Gpam 34
  • 84.78 (n)
mouse
(Mus musculus)
Mammalia Gpam 34 16 35
  • 84.64 (n)
chicken
(Gallus gallus)
Aves GPAM 34 35
  • 76.18 (n)
lizard
(Anolis carolinensis)
Reptilia GPAM 35
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia MGC145183 34
  • 66.59 (n)
Str.16265 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.15378 34
zebrafish
(Danio rerio)
Actinopterygii gpam 34 35
  • 65.28 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003687 34
  • 44.08 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5508 34 35
  • 42.11 (n)
worm
(Caenorhabditis elegans)
Secernentea acl-6 34 35
  • 43.31 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6605 35
  • 29 (a)
OneToMany
Species where no ortholog for GPAM was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GPAM Gene

ENSEMBL:
Gene Tree for GPAM (if available)
TreeFam:
Gene Tree for GPAM (if available)

Paralogs for GPAM Gene

Paralogs for GPAM Gene

(5) SIMAP similar genes for GPAM Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with GPAM: view

Variants for GPAM Gene

Sequence variations from dbSNP and Humsavar for GPAM Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs10528337 -- 112,200,188(+) TATAT(-/ATATATATATATATATATATAT)TTCAG intron-variant
rs10736219 -- 112,163,837(+) AAAAT(C/G)AACAC intron-variant
rs10749108 -- 112,166,254(+) TTTAG(A/G)CAACA intron-variant
rs10749109 -- 112,166,657(+) GGAGG(C/T)AATCA intron-variant
rs10749110 -- 112,166,659(+) AGGTA(A/T)TCATT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for GPAM Gene

Variant ID Type Subtype PubMed ID
nsv475728 CNV novel sequence insertion 20440878
nsv508608 CNV deletion 20534489
nsv7211 OTHER inversion 18451855
nsv831989 CNV gain 17160897

Variation tolerance for GPAM Gene

Residual Variation Intolerance Score: 30% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.36; 53.87% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for GPAM Gene

Human Gene Mutation Database (HGMD)
GPAM
SNPedia medical, phenotypic, and genealogical associations of SNPs for
GPAM

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GPAM Gene

Disorders for GPAM Gene

Relevant External Links for GPAM

Genetic Association Database (GAD)
GPAM
Human Genome Epidemiology (HuGE) Navigator
GPAM
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
GPAM

No disorders were found for GPAM Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for GPAM Gene

Publications for GPAM Gene

  1. AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase. (PMID: 18238778) Chen Y.Q. … Cao G. (J. Biol. Chem. 2008) 3 4 22 64
  2. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10997877) Nagase T. … Ohara O. (DNA Res. 2000) 2 3 4 64
  3. A Large-scale genetic association study of esophageal adenocarcinoma risk. (PMID: 20453000) Liu C.Y. … Christiani D.C. (Carcinogenesis 2010) 3 46 64
  4. Biological, clinical and population relevance of 95 loci for blood lipids. (PMID: 20686565) Teslovich T.M. … Kathiresan S. (Nature 2010) 3 46 64
  5. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson S.L. … O'Brien S.J. (PLoS ONE 2010) 3 46 64

Products for GPAM Gene

Sources for GPAM Gene

Content
Loading form....