Free for academic non-profit institutions. Other users need a Commercial license

Aliases for GMPS Gene

Aliases for GMPS Gene

  • Guanine Monophosphate Synthase 2 3 5
  • Guanine Monophosphate Synthetase 2 3
  • Glutamine Amidotransferase 3 4
  • GMP Synthetase 3 4
  • GMP Synthase 2 3
  • EC 6.3.5.2 4 58
  • GMP Synthase [Glutamine-Hydrolyzing] 3
  • Guanosine 5-Monophosphate Synthase 3
  • Testicular Tissue Protein Li 82 3
  • MLL/GMPS Fusion Protein 3
  • GATD7 3

External Ids for GMPS Gene

Previous GeneCards Identifiers for GMPS Gene

  • GC03P152441
  • GC03P156575
  • GC03P156869
  • GC03P156909
  • GC03P157071
  • GC03P155588
  • GC03P152982

Summaries for GMPS Gene

Entrez Gene Summary for GMPS Gene

  • In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq, Jul 2008]

GeneCards Summary for GMPS Gene

GMPS (Guanine Monophosphate Synthase) is a Protein Coding gene. Diseases associated with GMPS include Leukemia, Acute Myeloid and Pallister-Killian Syndrome. Among its related pathways are Metabolism and Purine metabolism. GO annotations related to this gene include enzyme binding and transferase activity.

UniProtKB/Swiss-Prot for GMPS Gene

  • Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.

Gene Wiki entry for GMPS Gene

Additional gene information for GMPS Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GMPS Gene

Genomics for GMPS Gene

Regulatory Elements for GMPS Gene

Enhancers for GMPS Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03H156814 1.6 FANTOM5 ENCODE dbSUPER 15.2 +948.3 948274 6 ARNT SIN3A FEZF1 ZNF2 YY1 ZNF143 ZNF207 FOS SP3 REST LINC00886 GMPS CCNL1 LEKR1 TIPARP
GH03H156549 1.4 ENCODE dbSUPER 16 +683.5 683512 6 HDGF PKNOX1 ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF766 ZNF207 GMPS ENSG00000272990 SSR3 KCNAB1 GC03M156535
GH03H156760 1.6 FANTOM5 Ensembl ENCODE dbSUPER 12.5 +893.5 893471 5 PKNOX1 FOXA2 ARNT THRB RCOR1 RUNX3 ZNF680 PRDM6 GLIS1 HMBOX1 LINC00886 TIPARP-AS1 LEKR1 GMPS GC03P156804 METTL15P1
GH03H155862 1.2 Ensembl ENCODE 14.2 -6.7 -6679 1 HDAC1 HDGF PKNOX1 ZBTB40 ZNF766 EGR1 SCRT2 FOS ATF7 CAVIN1 GMPS SLC33A1 PLCH1 LOC105374174
GH03H155804 1.1 ENCODE 11.9 -63.7 -63734 2 HDGF PKNOX1 ARNT ARID4B SIN3A DMAP1 YY1 ZNF207 ZNF143 REST GMPS C3orf33 PLCH1 SLC33A1 RPL7AP24
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around GMPS on UCSC Golden Path with GeneCards custom track

Promoters for GMPS Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000160707 1870 2601 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZNF766 ZNF143 ZNF207 SP3

Genomic Location for GMPS Gene

Chromosome:
3
Start:
155,869,430 bp from pter
End:
155,944,026 bp from pter
Size:
74,597 bases
Orientation:
Plus strand

Genomic View for GMPS Gene

Genes around GMPS on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GMPS Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GMPS Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GMPS Gene

Proteins for GMPS Gene

  • Protein details for GMPS Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P49915-GUAA_HUMAN
    Recommended name:
    GMP synthase [glutamine-hydrolyzing]
    Protein Accession:
    P49915
    Secondary Accessions:
    • A8K639
    • B4DXV7
    • F8W720

    Protein attributes for GMPS Gene

    Size:
    693 amino acids
    Molecular mass:
    76715 Da
    Quaternary structure:
    • Homodimer.

    Three dimensional structures from OCA and Proteopedia for GMPS Gene

    Alternative splice isoforms for GMPS Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for GMPS Gene

Selected DME Specific Peptides for GMPS Gene

P49915:
  • HIDNGFMR
  • HHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPA
  • GRELGLPE
  • PEEKRKIIG
  • GGPNSVY
  • EPLKDFHKDEVR
  • RHPFPGPG
  • LAQGTLRPDLIES
  • PVLGICYG

Post-translational modifications for GMPS Gene

  • Ubiquitination at posLast=6565, posLast=182182, posLast=183183, posLast=204204, posLast=389389, isoforms=2412, isoforms=2457, and isoforms=2535
  • Modification sites at PhosphoSitePlus

Other Protein References for GMPS Gene

Domains & Families for GMPS Gene

Gene Families for GMPS Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

genes like me logo Genes that share domains with GMPS: view

No data available for UniProtKB/Swiss-Prot for GMPS Gene

Function for GMPS Gene

Molecular function for GMPS Gene

GENATLAS Biochemistry:
guanosine 5-monophosphate synthetase
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + XMP + L-glutamine + H(2)O = AMP + diphosphate + GMP + L-glutamate.
UniProtKB/Swiss-Prot Function:
Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.

Enzyme Numbers (IUBMB) for GMPS Gene

Phenotypes From GWAS Catalog for GMPS Gene

Gene Ontology (GO) - Molecular Function for GMPS Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003921 GMP synthase activity IBA,TAS --
GO:0003922 GMP synthase (glutamine-hydrolyzing) activity IBA --
GO:0005524 ATP binding IEA --
GO:0016462 pyrophosphatase activity IEA --
GO:0016874 ligase activity IEA --
genes like me logo Genes that share ontologies with GMPS: view
genes like me logo Genes that share phenotypes with GMPS: view

Animal Model Products

CRISPR Products

miRNA for GMPS Gene

miRTarBase miRNAs that target GMPS

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for GMPS
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for GMPS Gene

Localization for GMPS Gene

Subcellular locations from UniProtKB/Swiss-Prot for GMPS Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GMPS gene
Compartment Confidence
cytosol 5
mitochondrion 2
nucleus 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for GMPS Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with GMPS: view

Pathways & Interactions for GMPS Gene

genes like me logo Genes that share pathways with GMPS: view

UniProtKB/Swiss-Prot P49915-GUAA_HUMAN

  • Pathway: Purine metabolism; GMP biosynthesis; GMP from XMP (L-Gln route): step 1/1.

SIGNOR curated interactions for GMPS Gene

Activates:
Is inactivated by:

Gene Ontology (GO) - Biological Process for GMPS Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006164 purine nucleotide biosynthetic process IEA --
GO:0006177 GMP biosynthetic process IBA,IEA --
GO:0006541 glutamine metabolic process IEA --
GO:0009113 purine nucleobase biosynthetic process TAS 8089153
GO:0009168 purine ribonucleoside monophosphate biosynthetic process TAS --
genes like me logo Genes that share ontologies with GMPS: view

Drugs & Compounds for GMPS Gene

(14) Drugs for GMPS Gene - From: DrugBank, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Glutamic Acid Approved Nutra Full agonist, Agonist, Target 236
L-Glutamine Approved, Investigational Nutra Full agonist, Agonist, Enzyme, substrate 0
Azathioprine Approved Pharma 183
Ammonia Approved Pharma 0
Water Approved Pharma 0

(18) Additional Compounds for GMPS Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
6-Thioguanosine monophosphate
6-Thioxanthine 5'-monophosphate
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
Xanthylic acid
  • (9-D-ribosylxanthine)-5'-phosphate
  • 5'-Xanthonylate monophosphate
  • Xanthosine 5'-phosphate
  • Xanthosine-5'-P
  • Xanthosine-5'-phosphate
523-98-8

(1) ApexBio Compounds for GMPS Gene

Compound Action Cas Number
Azathioprine 446-86-6
genes like me logo Genes that share compounds with GMPS: view

Drug Products

Transcripts for GMPS Gene

Unigene Clusters for GMPS Gene

Guanine monphosphate synthetase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for GMPS
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for GMPS Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17
SP1: -
SP2:

Relevant External Links for GMPS Gene

GeneLoc Exon Structure for
GMPS
ECgene alternative splicing isoforms for
GMPS

Expression for GMPS Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for GMPS Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for GMPS Gene

This gene is overexpressed in Lymph node (19.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GMPS Gene



Protein tissue co-expression partners for GMPS Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of GMPS Gene:

GMPS

SOURCE GeneReport for Unigene cluster for GMPS Gene:

Hs.591314

Evidence on tissue expression from TISSUES for GMPS Gene

  • Nervous system(2.8)
  • Bone marrow(2.6)
  • Blood(2.5)
  • Spleen(2.4)
  • Heart(2.3)
  • Liver(2.3)
  • Muscle(2.1)
genes like me logo Genes that share expression patterns with GMPS: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for GMPS Gene

Orthologs for GMPS Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for GMPS Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GMPS 33 34
  • 99.66 (n)
oppossum
(Monodelphis domestica)
Mammalia GMPS 34
  • 96 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GMPS 34
  • 96 (a)
OneToOne
cow
(Bos Taurus)
Mammalia GMPS 33 34
  • 95.23 (n)
dog
(Canis familiaris)
Mammalia GMPS 33 34
  • 94.57 (n)
rat
(Rattus norvegicus)
Mammalia Gmps 33
  • 92.02 (n)
mouse
(Mus musculus)
Mammalia Gmps 33 16 34
  • 91.58 (n)
chicken
(Gallus gallus)
Aves GMPS 33 34
  • 82.83 (n)
lizard
(Anolis carolinensis)
Reptilia GMPS 34
  • 94 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia gmps 33
  • 80.23 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.11147 33
zebrafish
(Danio rerio)
Actinopterygii gmps 33 34
  • 74.18 (n)
zgc66002 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.6472 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP010139 33
  • 58.63 (n)
fruit fly
(Drosophila melanogaster)
Insecta bur 35 33 34
  • 58.23 (n)
worm
(Caenorhabditis elegans)
Secernentea M106.4 35 33
  • 56.05 (n)
gmps-1 34
  • 46 (a)
OneToOne
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes GUA1 34 36
  • 42 (a)
OneToOne
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3703 34
  • 59 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4241 33
Species where no ortholog for GMPS was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GMPS Gene

ENSEMBL:
Gene Tree for GMPS (if available)
TreeFam:
Gene Tree for GMPS (if available)

Paralogs for GMPS Gene

Pseudogenes.org Pseudogenes for GMPS Gene

genes like me logo Genes that share paralogs with GMPS: view

No data available for Paralogs for GMPS Gene

Variants for GMPS Gene

Sequence variations from dbSNP and Humsavar for GMPS Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
rs1000007607 -- 155,905,090(+) GATCT(A/C)GACTC intron-variant
rs1000225992 -- 155,930,969(+) AGGTG(C/T)ATGCC intron-variant
rs1000253567 -- 155,878,690(+) ATATA(C/T)ATATA intron-variant
rs1000296175 -- 155,927,732(+) AAGTT(C/T)TGTAT intron-variant
rs1000340093 -- 155,937,311(+) TTGTG(G/T)CTCAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for GMPS Gene

Variant ID Type Subtype PubMed ID
esv3598287 CNV loss 21293372
esv3598288 CNV loss 21293372
esv3598289 CNV loss 21293372

Variation tolerance for GMPS Gene

Residual Variation Intolerance Score: 15% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.61; 30.94% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for GMPS Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GMPS

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GMPS Gene

Disorders for GMPS Gene

MalaCards: The human disease database

(2) MalaCards diseases for GMPS Gene - From: GeneTests, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
leukemia, acute myeloid
  • leukemia, acute myeloid, somatic
pallister-killian syndrome
  • isochromosome 12p syndrome
- elite association - COSMIC cancer census association via MalaCards
Search GMPS in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

GUAA_HUMAN
  • Note=A chromosomal aberration involving GMPS is found in acute myeloid leukemias. Translocation t(3,11)(q25,q23) with KMT2A/MLL1.

Relevant External Links for GMPS

Genetic Association Database (GAD)
GMPS
Human Genome Epidemiology (HuGE) Navigator
GMPS
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
GMPS
genes like me logo Genes that share disorders with GMPS: view

No data available for Genatlas for GMPS Gene

Publications for GMPS Gene

  1. Human GMP synthetase. Protein purification, cloning, and functional expression of cDNA. (PMID: 8089153) Hirst M … Lou L (The Journal of biological chemistry 1994) 2 3 4 22 60
  2. Human variation in alcohol response is influenced by variation in neuronal signaling genes. (PMID: 20201926) Joslyn G … White RL (Alcoholism, clinical and experimental research 2010) 3 45 60
  3. Common variants conferring risk of schizophrenia: a pathway analysis of GWAS data. (PMID: 20659789) Jia P … Zhao Z (Schizophrenia research 2010) 3 45 60
  4. Genetic variations in the HGPRT, ITPA, IMPDH1, IMPDH2, and GMPS genes in Japanese individuals. (PMID: 20045992) Kudo M … Hiratsuka M (Drug metabolism and pharmacokinetics 2009) 3 45 60
  5. EBNA1-mediated recruitment of a histone H2B deubiquitylating complex to the Epstein-Barr virus latent origin of DNA replication. (PMID: 19834552) Sarkari F … Frappier L (PLoS pathogens 2009) 3 22 60

Products for GMPS Gene

Sources for GMPS Gene

Content
Loading form....