Free for academic non-profit institutions. Other users need a Commercial license

Aliases for GGT7 Gene

Aliases for GGT7 Gene

  • Gamma-Glutamyltransferase 7 2 3 5
  • Gamma-Glutamyltransferase-Like 3 2 3 4
  • Gamma-Glutamyltransferase-Like 5 3 4
  • Gamma-Glutamyltranspeptidase 7 3 4
  • Glutathione Hydrolase 7 3 4
  • EC 2.3.2.2 4 58
  • GGT 7 3 4
  • GGTL3 3 4
  • GGTL5 3 4
  • Gamma-Glutamyltranspeptidase-Like 3 3
  • Gamma-Glutamyltransferase 4 3
  • EC 3.4.19.13 4
  • D20S101 3
  • GGT4 3

External Ids for GGT7 Gene

Previous HGNC Symbols for GGT7 Gene

  • GGTL5
  • GGTL3

Previous GeneCards Identifiers for GGT7 Gene

  • GC20M032897
  • GC20M033435
  • GC20M030198

Summaries for GGT7 Gene

Entrez Gene Summary for GGT7 Gene

  • This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the liver or kidney. The protein encoded by this gene consists of a heavy and a light chain, and it can interact with CT120, a plasma membrane-associated protein that is possibly involved in lung carcinogenesis. [provided by RefSeq, Jul 2008]

GeneCards Summary for GGT7 Gene

GGT7 (Gamma-Glutamyltransferase 7) is a Protein Coding gene. Among its related pathways are Glutathione metabolism and Metabolism. GO annotations related to this gene include gamma-glutamyltransferase activity and glutathione hydrolase activity. An important paralog of this gene is GGT1.

UniProtKB/Swiss-Prot for GGT7 Gene

  • Cleaves glutathione conjugates.

Gene Wiki entry for GGT7 Gene

Additional gene information for GGT7 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for GGT7 Gene

Genomics for GGT7 Gene

Regulatory Elements for GGT7 Gene

Enhancers for GGT7 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH20H035436 1.2 Ensembl ENCODE 42.5 -565.2 -565237 3 ATF1 ZNF493 ARID4B GLIS2 ZNF302 ZNF416 ZNF143 ATF7 MCM3 YY2 UQCC1 RBM12 GGT7 NCOA6 RBM39 AAR2 CPNE1 PROCR ERGIC3 MMP24-AS1
GH20H035765 1.8 FANTOM5 ENCODE dbSUPER 10.9 -896.7 -896686 9 MLX FEZF1 DMAP1 YY1 SLC30A9 ZNF416 ZNF548 SP3 NFYC SSRP1 CPNE1 RBM12 RBM39 NCOA6 ERGIC3 PHF20 AAR2 DLGAP4-AS1 TRPC4AP PROCR
GH20H034389 1.5 Ensembl ENCODE dbSUPER 10.7 +482.5 482455 2 HDGF FOXA2 SIN3A ZNF2 YY1 GTF3C2 ZNF121 GLIS2 KLF7 ATF7 CDK5RAP1 NCOA6 TRPC4AP ZNF341-AS1 EIF6 GGT7 MAP1LC3A ENSG00000201498 GC20M034402
GH20H035659 1.4 ENCODE dbSUPER 11.3 -790.0 -789973 5 HDGF PKNOX1 MLX ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 CPNE1 RBM39 RBM12 EIF6 ERGIC3 NFS1 ROMO1 TRPC4AP GGT7 PHF20
GH20H034110 1.4 ENCODE dbSUPER 10.2 +761.1 761058 3 HDGF PKNOX1 FOXA2 ARNT ARID4B SIN3A DMAP1 YY1 SLC30A9 ZNF766 NCOA6 GGT7 MAP1LC3A RALY EIF2S2 MIR4755
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around GGT7 on UCSC Golden Path with GeneCards custom track

Promoters for GGT7 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000136466 160 1001 HDGF PKNOX1 MLX ARID4B SIN3A DMAP1 ZNF2 SLC30A9 ZNF143 SP3

Genomic Location for GGT7 Gene

Chromosome:
20
Start:
34,844,720 bp from pter
End:
34,872,860 bp from pter
Size:
28,141 bases
Orientation:
Minus strand

Genomic View for GGT7 Gene

Genes around GGT7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
GGT7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for GGT7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for GGT7 Gene

Proteins for GGT7 Gene

  • Protein details for GGT7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UJ14-GGT7_HUMAN
    Recommended name:
    Gamma-glutamyltransferase 7
    Protein Accession:
    Q9UJ14
    Secondary Accessions:
    • Q8N899
    • Q8NF66
    • Q9BYP5
    • Q9BYP6

    Protein attributes for GGT7 Gene

    Size:
    662 amino acids
    Molecular mass:
    70467 Da
    Quaternary structure:
    • Heterodimer composed of the light and heavy chains. The active site is located in the light chain (By similarity). Isoform 3 interacts with FAM57A.
    SequenceCaution:
    • Sequence=BAC03394.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for GGT7 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for GGT7 Gene

Selected DME Specific Peptides for GGT7 Gene

Q9UJ14:
  • ECSCRQDGLTVIVTACLTFATGVTVAL
  • EKPVCGVYRGHLVLSP
  • PLRGRKDEDAFLGDPDTDPDSFLKSARLQRLPSSSSEMGS
  • MQIYFGDPQIF
  • PPLPGSLL
  • PGKRPLS
  • PPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIA

Post-translational modifications for GGT7 Gene

  • Glycosylation at posLast=198198, isoforms=4267, posLast=283283, isoforms=6330, posLast=353353, isoforms=394, isoforms=452, isoforms=519, isoforms=523, and isoforms=586
  • Modification sites at PhosphoSitePlus

Domains & Families for GGT7 Gene

Gene Families for GGT7 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for GGT7 Gene

Graphical View of Domain Structure for InterPro Entry

Q9UJ14

UniProtKB/Swiss-Prot:

GGT7_HUMAN :
  • Belongs to the gamma-glutamyltransferase family.
Family:
  • Belongs to the gamma-glutamyltransferase family.
genes like me logo Genes that share domains with GGT7: view

Function for GGT7 Gene

Molecular function for GGT7 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
A (5-L-glutamyl)-peptide + an amino acid = a peptide + a 5-L-glutamyl amino acid.
UniProtKB/Swiss-Prot CatalyticActivity:
Glutathione + H(2)O = L-cysteinylglycine + L-glutamate.
UniProtKB/Swiss-Prot Function:
Cleaves glutathione conjugates.

Enzyme Numbers (IUBMB) for GGT7 Gene

Phenotypes From GWAS Catalog for GGT7 Gene

Gene Ontology (GO) - Molecular Function for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 25416956
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0016787 hydrolase activity IEA --
GO:0036374 glutathione hydrolase activity IEA --
genes like me logo Genes that share ontologies with GGT7: view

Phenotypes for GGT7 Gene

genes like me logo Genes that share phenotypes with GGT7: view

Animal Model Products

  • Taconic Biosciences Mouse Models for GGT7

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for GGT7
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for GGT7 Gene

Localization for GGT7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for GGT7 Gene

Membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for GGT7 gene
Compartment Confidence
plasma membrane 5
peroxisome 1
cytosol 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleus (2)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with GGT7: view

Pathways & Interactions for GGT7 Gene

genes like me logo Genes that share pathways with GGT7: view

Pathways by source for GGT7 Gene

UniProtKB/Swiss-Prot Q9UJ14-GGT7_HUMAN

  • Pathway: Sulfur metabolism; glutathione metabolism.

Gene Ontology (GO) - Biological Process for GGT7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0006749 glutathione metabolic process IEA --
GO:0006750 glutathione biosynthetic process IEA --
GO:0006751 glutathione catabolic process IEA --
GO:1901750 leukotriene D4 biosynthetic process ISS --
genes like me logo Genes that share ontologies with GGT7: view

No data available for SIGNOR curated interactions for GGT7 Gene

Drugs & Compounds for GGT7 Gene

(8) Drugs for GGT7 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carbon dioxide Approved, Vet_approved Pharma 0
Famotidine Approved Pharma Histamine H2-receptor antagonist 62
Water Approved Pharma 0
Glutamic Acid Approved Nutra Full agonist, Agonist 236
Glutathione Approved Nutra 0

(9) Additional Compounds for GGT7 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
5-L-Glutamyl-taurine
  • 5-Glutamyl-taurine
beta-Aminopropionitrile
  • 2-Cyanoethylamine
  • 3-Aminopropanenitrile
  • 3-Aminopropionitrile
  • 3-Aminopropiononitrile
  • Aminopropionitrile
151-18-8
cysteinylglycine
  • Cys-Gly
  • L-Cysteinylglycine
  • N-Cysteinyl Glycine
  • N-Cysteinyl-Glycine
  • N-L-Cysteinyl-Glycine
19246-18-5
gamma-Glutamyl-beta-aminopropiononitrile
gamma-Glutamyl-beta-cyanoalanine
genes like me logo Genes that share compounds with GGT7: view

Transcripts for GGT7 Gene

Unigene Clusters for GGT7 Gene

Gamma-glutamyltransferase 7:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for GGT7
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for GGT7 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b · 3c ^ 4a · 4b · 4c · 4d ^ 5a · 5b · 5c ^ 6a · 6b · 6c · 6d · 6e ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ·
SP1: - - - - - - -
SP2: - - -
SP3: - - - - -
SP4: - - - -
SP5: -
SP6: - - - -
SP7: - - -
SP8: - - - - - - - -
SP9:
SP10: - -
SP11: -
SP12:
SP13:

ExUns: 9d ^ 10a · 10b ^ 11 ^ 12a · 12b ^ 13 ^ 14a · 14b ^ 15 ^ 16a · 16b ^ 17
SP1:
SP2:
SP3:
SP4:
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: -
SP13:

Relevant External Links for GGT7 Gene

GeneLoc Exon Structure for
GGT7
ECgene alternative splicing isoforms for
GGT7

Expression for GGT7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for GGT7 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for GGT7 Gene

This gene is overexpressed in Frontal cortex (23.5), Brain (9.7), and Retina (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for GGT7 Gene



NURSA nuclear receptor signaling pathways regulating expression of GGT7 Gene:

GGT7

SOURCE GeneReport for Unigene cluster for GGT7 Gene:

Hs.433738

mRNA Expression by UniProt/SwissProt for GGT7 Gene:

Q9UJ14-GGT7_HUMAN
Tissue specificity: Widely expressed, but at low level, except in the airway epithelial cells. Detected in brain, heart, kidney, liver, lung, spleen, testis and trachea.

Evidence on tissue expression from TISSUES for GGT7 Gene

  • Spleen(4.1)
  • Nervous system(3.9)
genes like me logo Genes that share expression patterns with GGT7: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for GGT7 Gene

Orthologs for GGT7 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for GGT7 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia GGT7 33 34
  • 97.81 (n)
cow
(Bos Taurus)
Mammalia GGT7 33 34
  • 91.99 (n)
dog
(Canis familiaris)
Mammalia GGT7 33 34
  • 91.34 (n)
mouse
(Mus musculus)
Mammalia Ggt7 16 34 33
  • 89.88 (n)
rat
(Rattus norvegicus)
Mammalia Ggt7 33
  • 89.02 (n)
oppossum
(Monodelphis domestica)
Mammalia GGT7 34
  • 87 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia GGT7 34
  • 77 (a)
OneToOne
chicken
(Gallus gallus)
Aves GGT7 33 34
  • 68.19 (n)
lizard
(Anolis carolinensis)
Reptilia GGT7 34
  • 69 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ggt7 33
  • 62.16 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.9126 33
zebrafish
(Danio rerio)
Actinopterygii LOC101882295 33
  • 59.58 (n)
GGT7 34
  • 54 (a)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea Y97E10AR.2 34
  • 13 (a)
OneToOne
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ECM38 34
  • 21 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.5921 34
  • 30 (a)
OneToOne
Species where no ortholog for GGT7 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for GGT7 Gene

ENSEMBL:
Gene Tree for GGT7 (if available)
TreeFam:
Gene Tree for GGT7 (if available)

Paralogs for GGT7 Gene

Paralogs for GGT7 Gene

(1) SIMAP similar genes for GGT7 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with GGT7: view

Variants for GGT7 Gene

Sequence variations from dbSNP and Humsavar for GGT7 Gene

SNP ID Clin Chr 20 pos Sequence Context AA Info Type
rs1000027101 -- 34,847,434(+) CCTAC(C/T)GCTTC intron-variant
rs1000196567 -- 34,873,296(+) TCCTC(C/T)TCCGA upstream-variant-2KB
rs1000461529 -- 34,862,726(+) CCCTC(A/T)CCCTA intron-variant
rs1000495779 -- 34,854,359(+) GCTGA(C/T)AGGAA intron-variant
rs1000717154 -- 34,868,146(+) CAGGC(A/G)TGAGC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for GGT7 Gene

Variant ID Type Subtype PubMed ID
esv3567955 CNV loss 25503493
nsv1055447 CNV loss 25217958
nsv954027 CNV deletion 24416366
nsv964393 CNV duplication 23825009

Variation tolerance for GGT7 Gene

Residual Variation Intolerance Score: 31.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.76; 33.37% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for GGT7 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
GGT7

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for GGT7 Gene

Disorders for GGT7 Gene

Relevant External Links for GGT7

Genetic Association Database (GAD)
GGT7
Human Genome Epidemiology (HuGE) Navigator
GGT7
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
GGT7

No disorders were found for GGT7 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for GGT7 Gene

Publications for GGT7 Gene

  1. The human gamma-glutamyltransferase gene family. (PMID: 18357469) Heisterkamp N … Sneddon TP (Human genetics 2008) 2 3 4 60
  2. Molecular cloning and characterization of CT120, a novel membrane-associated gene involved in amino acid transport and glutathione metabolism. (PMID: 12270127) He X … Gu J (Biochemical and biophysical research communications 2002) 3 4 22 60
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 45 60
  4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 60
  5. Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. (PMID: 12693554) Jikuya H … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2003) 3 4 60

Products for GGT7 Gene

Sources for GGT7 Gene

Content
Loading form....