Free for academic non-profit institutions. Other users need a Commercial license

Aliases for G3BP1 Gene

Aliases for G3BP1 Gene

  • G3BP Stress Granule Assembly Factor 1 2 3 5
  • Ras-GTPase-Activating Protein SH3-Domain-Binding Protein 2 3
  • GTPase Activating Protein (SH3 Domain) Binding Protein 1 2 3
  • GAP SH3 Domain-Binding Protein 1 3 4
  • ATP-Dependent DNA Helicase VIII 3 4
  • DNA Helicase VIII 2 3
  • G3BP-1 3 4
  • G3BP 3 4
  • Ras GTPase-Activating Protein-Binding Protein 1 3
  • RasGAP-Associated Endoribonuclease G3BP 3
  • GAP Binding Protein 3
  • EC 3.6.4.12 4
  • EC 3.6.4.13 4
  • HDH-VIII 3
  • HDH VIII 4
  • EC 3.6.1 61

External Ids for G3BP1 Gene

Previous GeneCards Identifiers for G3BP1 Gene

  • GC05P151132
  • GC05P151151
  • GC05P146296

Summaries for G3BP1 Gene

Entrez Gene Summary for G3BP1 Gene

  • This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

GeneCards Summary for G3BP1 Gene

G3BP1 (G3BP Stress Granule Assembly Factor 1) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and mRNA binding. An important paralog of this gene is G3BP2.

UniProtKB/Swiss-Prot for G3BP1 Gene

  • May be a regulated effector of stress granule assembly. Phosphorylation-dependent sequence-specific endoribonuclease in vitro. Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3-UTR. ATP- and magnesium-dependent helicase. Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3 tail or hanging tails at both 5- and 3-ends. Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency. Acts unidirectionally by moving in the 5 to 3 direction along the bound single-stranded DNA.

Gene Wiki entry for G3BP1 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for G3BP1 Gene

Genomics for G3BP1 Gene

Regulatory Elements for G3BP1 Gene

Enhancers for G3BP1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH05F151737 1.1 FANTOM5 Ensembl ENCODE 11.7 -29.0 -28986 9.9 HDGF ATF1 PKNOX1 ARNT WRNIP1 SIN3A ARID4B YBX1 ZNF2 ZNF143 RPLP1P6 ZNF300 G3BP1 ATOX1 SPARC GC05M151735 LOC105378235
GH05F151656 0.6 ENCODE 11.5 -113.8 -113788 1.4 ESRRA PKNOX1 ZIC2 OSR2 PBX2 GLIS1 CUX1 SP7 EGR2 LOC105378231 SPARC RPLP1P6 G3BP1 ATOX1 LOC105378235 FAT2 CTB-113P19.1
GH05F151668 0.5 Ensembl ENCODE 11.3 -92.7 -92744 20.0 HDGF PKNOX1 ARNT CREB3L1 ARID4B SIN3A ZNF48 YY1 GATA2 ZNF143 LOC105378231 CTB-113P19.1 LOC105378235 RPLP1P6 SPARC ATOX1 G3BP1
GH05F151729 0.2 ENCODE 11.1 -41.3 -41291 0.1 GATA3 CBX3 SETDB1 RPLP1P6 SPARC LOC105378235 ATOX1 G3BP1 ENSG00000272112 GC05M151735
GH05F151728 0.5 FANTOM5 11.1 -42.3 -42346 0.4 HDGF ZNF687 GLIS1 TSC22D4 KLF7 RAD21 ZNF785 YY1 ZKSCAN1 SPARC LOC105378235 ATOX1 RPLP1P6 G3BP1 ENSG00000272112 GC05M151735
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around G3BP1 on UCSC Golden Path with GeneCards custom track

Promoters for G3BP1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001294241 1455 4601 HDGF PKNOX1 ARNT MLX WRNIP1 ZFP64 ARID4B SIN3A FEZF1 DMAP1

Genomic Location for G3BP1 Gene

Chromosome:
5
Start:
151,771,045 bp from pter
End:
151,812,785 bp from pter
Size:
41,741 bases
Orientation:
Plus strand

Genomic View for G3BP1 Gene

Genes around G3BP1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
G3BP1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for G3BP1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for G3BP1 Gene

Proteins for G3BP1 Gene

  • Protein details for G3BP1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13283-G3BP1_HUMAN
    Recommended name:
    Ras GTPase-activating protein-binding protein 1
    Protein Accession:
    Q13283
    Secondary Accessions:
    • Q5HYE9

    Protein attributes for G3BP1 Gene

    Size:
    466 amino acids
    Molecular mass:
    52164 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Binds to the SH3 domain of Ras GTPase-activating protein (RASA1) in proliferating cells. No interaction in quiescent cells Component of a TAU mRNP complex, at least composed of IGF2BP1, ELAVL4 and G3BP1 (By similarity). Interacts with USP10, and may regulate it. Forms homodimers and oligomers. Interacts with RPTOR and SPAG5; this complex is increased by oxidative stress. Interacts with ATXN2L (PubMed:23209657).

    Three dimensional structures from OCA and Proteopedia for G3BP1 Gene

    Alternative splice isoforms for G3BP1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for G3BP1 Gene

Selected DME Specific Peptides for G3BP1 Gene

Q13283:
  • QEDLRTFSWASVTSKNLPPSGAVPVTG
  • PPHVVKVPASQPRPESKP
  • VRLNVEEKKTRAAREGDRRDNRLRGPGGPRGG
  • QRPQRDQRVREQRIN
  • PPQRGPRP
  • GNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFR

Post-translational modifications for G3BP1 Gene

  • Arg-435 is dimethylated, probably to asymmetric dimethylarginine.
  • Phosphorylated exclusively on serine residues. Hyperphosphorylated in quiescent fibroblasts. Hypophosphorylation leads to a decrease in endoribonuclease activity (By similarity). RASA1-dependent phosphorylation of Ser-149 induces a conformational change that prevents self-association. Dephosphorylation after HRAS activation is required for stress granule assembly. Ser-149 phosphorylation induces partial nuclear localization.
  • Ubiquitination at Lys 36, Lys 59, Lys 64, Lys 76, and Lys 123
  • Modification sites at PhosphoSitePlus

Domains & Families for G3BP1 Gene

Gene Families for G3BP1 Gene

Suggested Antigen Peptide Sequences for G3BP1 Gene

Graphical View of Domain Structure for InterPro Entry

Q13283

UniProtKB/Swiss-Prot:

G3BP1_HUMAN :
  • The NTF2 domain mediates multimerization.
Domain:
  • The NTF2 domain mediates multimerization.
  • Contains 1 NTF2 domain.
  • Contains 1 RRM (RNA recognition motif) domain.
genes like me logo Genes that share domains with G3BP1: view

Function for G3BP1 Gene

Molecular function for G3BP1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
May be a regulated effector of stress granule assembly. Phosphorylation-dependent sequence-specific endoribonuclease in vitro. Cleaves exclusively between cytosine and adenine and cleaves MYC mRNA preferentially at the 3-UTR. ATP- and magnesium-dependent helicase. Unwinds preferentially partial DNA and RNA duplexes having a 17 bp annealed portion and either a hanging 3 tail or hanging tails at both 5- and 3-ends. Unwinds DNA/DNA, RNA/DNA, and RNA/RNA substrates with comparable efficiency. Acts unidirectionally by moving in the 5 to 3 direction along the bound single-stranded DNA.

Enzyme Numbers (IUBMB) for G3BP1 Gene

Gene Ontology (GO) - Molecular Function for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003677 DNA binding IEA --
GO:0003723 RNA binding IEA --
GO:0003729 mRNA binding IBA --
GO:0004003 ATP-dependent DNA helicase activity TAS 9889278
genes like me logo Genes that share ontologies with G3BP1: view
genes like me logo Genes that share phenotypes with G3BP1: view

Animal Models for G3BP1 Gene

MGI Knock Outs for G3BP1:

Animal Model Products

miRNA for G3BP1 Gene

miRTarBase miRNAs that target G3BP1

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for G3BP1 Gene

Localization for G3BP1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for G3BP1 Gene

Cytoplasm. Cytoplasm, cytosol. Cytoplasmic granule. Cell membrane. Nucleus. Note=Cytoplasmic in proliferating cells, can be recruited to the plasma membrane in exponentially growing cells (By similarity). Cytosolic and partially nuclear in resting cells. Recruited to stress granules (SGs) upon either arsenite or high temperature treatment. Recruitment to SGs is influenced by HRAS. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for G3BP1 Gene COMPARTMENTS Subcellular localization image for G3BP1 gene
Compartment Confidence
cytosol 5
nucleus 5
plasma membrane 5

Gene Ontology (GO) - Cellular Components for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005634 nucleus IEA,TAS --
GO:0005737 cytoplasm IDA --
GO:0005829 cytosol IEA,IBA --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with G3BP1: view

Pathways & Interactions for G3BP1 Gene

SuperPathways for G3BP1 Gene

No Data Available

Gene Ontology (GO) - Biological Process for G3BP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006810 transport IEA --
GO:0007265 Ras protein signal transduction TAS 8649363
GO:0032508 DNA duplex unwinding IEA --
GO:0090090 negative regulation of canonical Wnt signaling pathway IEA --
GO:0090305 nucleic acid phosphodiester bond hydrolysis IEA --
genes like me logo Genes that share ontologies with G3BP1: view

No data available for Pathways by source and SIGNOR curated interactions for G3BP1 Gene

Drugs & Compounds for G3BP1 Gene

(7) Drugs for G3BP1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phenylephrine Approved Pharma Full agonist, Agonist 440
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(1) Additional Compounds for G3BP1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with G3BP1: view

Transcripts for G3BP1 Gene

Unigene Clusters for G3BP1 Gene

GTPase activating protein (SH3 domain) binding protein 1:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for G3BP1 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b · 3c · 3d ^ 4a · 4b ^ 5a · 5b · 5c ^ 6 ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14a · 14b
SP1: - - -
SP2: - - - -
SP3: - - - - -
SP4: - - - - - - - - - - - - - - - -
SP5: - - -
SP6: - -
SP7: -
SP8: - -

Relevant External Links for G3BP1 Gene

GeneLoc Exon Structure for
G3BP1
ECgene alternative splicing isoforms for
G3BP1

Expression for G3BP1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for G3BP1 Gene

Protein differential expression in normal tissues from HIPED for G3BP1 Gene

This gene is overexpressed in Nasal epithelium (7.7) and Lung (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for G3BP1 Gene



Protein tissue co-expression partners for G3BP1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of G3BP1 Gene:

G3BP1

SOURCE GeneReport for Unigene cluster for G3BP1 Gene:

Hs.587054

mRNA Expression by UniProt/SwissProt for G3BP1 Gene:

Q13283-G3BP1_HUMAN
Tissue specificity: Ubiquitous.
genes like me logo Genes that share expression patterns with G3BP1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for G3BP1 Gene

Orthologs for G3BP1 Gene

This gene was present in the common ancestor of animals.

Orthologs for G3BP1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia G3BP1 34 35
  • 99.79 (n)
cow
(Bos Taurus)
Mammalia G3BP 35
  • 97 (a)
OneToOne
G3BP1 34
  • 91.68 (n)
dog
(Canis familiaris)
Mammalia G3BP1 34 35
  • 93.05 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 88 (a)
OneToMany
-- 35
  • 86 (a)
OneToMany
-- 35
  • 80 (a)
OneToMany
rat
(Rattus norvegicus)
Mammalia G3bp1 34
  • 86.71 (n)
mouse
(Mus musculus)
Mammalia G3bp1 34 16 35
  • 86.49 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia G3BP1 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves G3BP1 34 35
  • 80.53 (n)
lizard
(Anolis carolinensis)
Reptilia G3BP1 35
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia g3bp1 34
  • 72.4 (n)
African clawed frog
(Xenopus laevis)
Amphibia g3bp-prov 34
zebrafish
(Danio rerio)
Actinopterygii g3bp1 34 35
  • 64.43 (n)
wufj17h05 34
fruit fly
(Drosophila melanogaster)
Insecta rin 35
  • 23 (a)
OneToMany
Species where no ortholog for G3BP1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for G3BP1 Gene

ENSEMBL:
Gene Tree for G3BP1 (if available)
TreeFam:
Gene Tree for G3BP1 (if available)

Paralogs for G3BP1 Gene

Paralogs for G3BP1 Gene

Pseudogenes.org Pseudogenes for G3BP1 Gene

genes like me logo Genes that share paralogs with G3BP1: view

Variants for G3BP1 Gene

Sequence variations from dbSNP and Humsavar for G3BP1 Gene

SNP ID Clin Chr 05 pos Sequence Context AA Info Type
rs10036616 -- 151,805,901(+) TATGG(A/T)TAGCC utr-variant-3-prime
rs10036976 -- 151,794,089(+) GTCAC(C/G)AATGG intron-variant
rs10055248 -- 151,793,884(+) tggcg(C/T)gcccc intron-variant
rs10059511 -- 151,795,641(+) CCTTT(C/G)TTGGA intron-variant
rs10066917 -- 151,809,712(+) ATATG(G/T)TGATC utr-variant-3-prime

Structural Variations from Database of Genomic Variants (DGV) for G3BP1 Gene

Variant ID Type Subtype PubMed ID
esv3417276 CNV insertion 20981092
nsv5070 CNV insertion 18451855
nsv980745 CNV duplication 23825009

Variation tolerance for G3BP1 Gene

Residual Variation Intolerance Score: 12.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.07; 21.90% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for G3BP1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
G3BP1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for G3BP1 Gene

Disorders for G3BP1 Gene

Relevant External Links for G3BP1

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
G3BP1

No disorders were found for G3BP1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for G3BP1 Gene

Publications for G3BP1 Gene

  1. Human DNA helicase VIII: a DNA and RNA helicase corresponding to the G3BP protein, an element of the ras transduction pathway. (PMID: 9889278) Costa M. … Falaschi A. (Nucleic Acids Res. 1999) 2 3 4 22 64
  2. A Ras-GTPase-activating protein SH3-domain-binding protein. (PMID: 8649363) Parker F. … Tocque B. (Mol. Cell. Biol. 1996) 2 3 4 22 64
  3. The RasGAP-associated endoribonuclease G3BP assembles stress granules. (PMID: 12642610) Tourriere H. … Tazi J. (J. Cell Biol. 2003) 3 4 22 64
  4. Ras-GAP SH3 domain binding protein (G3BP) is a modulator of USP10, a novel human ubiquitin specific protease. (PMID: 11439350) Soncini C. … Draetta G. (Oncogene 2001) 3 4 22 64
  5. eEF2 and Ras-GAP SH3 domain-binding protein (G3BP1) modulate stress granule assembly during HIV-1 infection. (PMID: 25229650) Valiente-EcheverrA-a F. … Mouland A.J. (Nat Commun 2014) 2 3 64

Products for G3BP1 Gene

Sources for G3BP1 Gene

Content
Loading form....