Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FUT8 Gene

Aliases for FUT8 Gene

  • Fucosyltransferase 8 2 3 4 5
  • GDP-L-Fuc:N-Acetyl-Beta-D-Glucosaminide Alpha1,6-Fucosyltransferase 3 4
  • Fucosyltransferase 8 (Alpha (1,6) Fucosyltransferase) 2 3
  • GDP-Fucose--Glycoprotein Fucosyltransferase 3 4
  • Glycoprotein 6-Alpha-L-Fucosyltransferase 3 4
  • Alpha1-6FucT 3 4
  • EC 2.4.1.68 4 61
  • Alpha (1,6) Fucosyltransferase 2
  • Alpha-(1,6)-Fucosyltransferase 3

External Ids for FUT8 Gene

Previous GeneCards Identifiers for FUT8 Gene

  • GC14P063206
  • GC14P059672
  • GC14P063867
  • GC14P064947
  • GC14P065877
  • GC14P046046

Summaries for FUT8 Gene

Entrez Gene Summary for FUT8 Gene

  • This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]

GeneCards Summary for FUT8 Gene

FUT8 (Fucosyltransferase 8) is a Protein Coding gene. Diseases associated with FUT8 include Pancreatic Acinar Cell Adenocarcinoma and Smoldering Myeloma. Among its related pathways are N-glycan antennae elongation in the medial/trans-Golgi and Transport to the Golgi and subsequent modification. GO annotations related to this gene include SH3 domain binding and glycoprotein 6-alpha-L-fucosyltransferase activity.

UniProtKB/Swiss-Prot for FUT8 Gene

  • Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.

Gene Wiki entry for FUT8 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FUT8 Gene

Genomics for FUT8 Gene

Regulatory Elements for FUT8 Gene

Enhancers for FUT8 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH14G065224 1.8 FANTOM5 Ensembl ENCODE dbSUPER 15.5 -182.0 -181973 8.4 PKNOX1 FOXA2 ARID4B SIN3A DMAP1 ZBTB7B YY1 CBX5 FOS SP5 FUT8 LINC02324 LOC100420096
GH14G065281 1.5 FANTOM5 Ensembl ENCODE dbSUPER 11.5 -127.9 -127881 2.3 CTCF HDGF PKNOX1 WRNIP1 RBBP5 KAT2B HDAC2 POLR2A CEBPA TARDBP FUT8 FNTB PTBP1P GC14M065292
GH14G065430 1 Ensembl ENCODE 15.8 +22.5 22476 4.2 HDAC1 PKNOX1 ZNF146 TAL1 EBF1 GATA3 GATA2 ZSCAN29 ZNF584 RELB FUT8 RPL21P8 MIR625 FUT8-AS1 GC14M065468
GH14G065235 1.7 FANTOM5 Ensembl ENCODE dbSUPER 7.7 -172.6 -172624 5.0 ELF3 FOXA2 ATF1 ARID4B DNMT3B THRB ZNF48 RARA TCF12 GATA2 FUT8 LOC100420096 GC14M065218
GH14G065242 1.8 FANTOM5 Ensembl ENCODE dbSUPER 5.8 -167.0 -167018 2.7 HDGF PKNOX1 ATF1 FOXA2 MLX ARID4B YBX1 ZNF48 ZBTB7B TCF12 FUT8 LOC100420096 GC14M065218
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FUT8 on UCSC Golden Path with GeneCards custom track

Genomic Location for FUT8 Gene

Chromosome:
14
Start:
65,410,592 bp from pter
End:
65,744,121 bp from pter
Size:
333,530 bases
Orientation:
Plus strand

Genomic View for FUT8 Gene

Genes around FUT8 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FUT8 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FUT8 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FUT8 Gene

Proteins for FUT8 Gene

  • Protein details for FUT8 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BYC5-FUT8_HUMAN
    Recommended name:
    Alpha-(1,6)-fucosyltransferase
    Protein Accession:
    Q9BYC5
    Secondary Accessions:
    • B4DFS7
    • G3V5N0
    • O00235
    • Q8IUA5
    • Q9BYC6
    • Q9P2U5
    • Q9P2U6

    Protein attributes for FUT8 Gene

    Size:
    575 amino acids
    Molecular mass:
    66516 Da
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for FUT8 Gene

    Alternative splice isoforms for FUT8 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FUT8 Gene

Selected DME Specific Peptides for FUT8 Gene

Q9BYC5:
  • LEGNELQRHADE
  • GGQNAHN
  • TGHWSGE
  • LRRRIENGAKELWFFLQSELKKLK
  • ETCTDRSG
  • LLKEAKTKY
  • EAAFHPIEEY
  • EIPMEPGDIIGVAGNHWDGY
  • EPGDIIGVAGNHWDGYSKG
  • WTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHS
  • KAKEQIE
  • PRPPYLPLAVPEDLA
  • RVYLATDDP
  • MTDLYYLSQTDGAGDWRE
  • WRYATGGWETVF
  • NKGCGYGCQLHHVVYCF
  • HGDPAVWWVSQFVKYLIRPQPWLEKEIEE

Post-translational modifications for FUT8 Gene

Domains & Families for FUT8 Gene

Gene Families for FUT8 Gene

Protein Domains for FUT8 Gene

Suggested Antigen Peptide Sequences for FUT8 Gene

Graphical View of Domain Structure for InterPro Entry

Q9BYC5

UniProtKB/Swiss-Prot:

FUT8_HUMAN :
  • Belongs to the glycosyltransferase 23 family.
Family:
  • Belongs to the glycosyltransferase 23 family.
genes like me logo Genes that share domains with FUT8: view

Function for FUT8 Gene

Molecular function for FUT8 Gene

GENATLAS Biochemistry:
fucosyltransferase,alpha (1,6),8,involved in the biosynthesis of asparagine-linked glycoprotein oligosaccharides
UniProtKB/Swiss-Prot CatalyticActivity:
GDP-beta-L-fucose + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)asparagine = GDP + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-(alpha-L-fucosyl-(1->6))-N-acetyl-beta-D-glucosaminyl)asparagine.
UniProtKB/Swiss-Prot Function:
Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.

Enzyme Numbers (IUBMB) for FUT8 Gene

Gene Ontology (GO) - Molecular Function for FUT8 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008424 glycoprotein 6-alpha-L-fucosyltransferase activity TAS 11698403
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0017124 SH3 domain binding IEA --
GO:0046921 alpha-(1->6)-fucosyltransferase activity IEA --
genes like me logo Genes that share ontologies with FUT8: view
genes like me logo Genes that share phenotypes with FUT8: view

Animal Models for FUT8 Gene

MGI Knock Outs for FUT8:

Animal Model Products

  • Taconic Biosciences Mouse Models for FUT8

CRISPR Products

miRNA for FUT8 Gene

miRTarBase miRNAs that target FUT8

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FUT8 Gene

Localization for FUT8 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FUT8 Gene

Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Membrane-bound form in trans cisternae of Golgi. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FUT8 gene
Compartment Confidence
extracellular 5
cytosol 5
golgi apparatus 5
endoplasmic reticulum 2
plasma membrane 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for FUT8 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005794 Golgi apparatus NAS 11698403
GO:0005829 cytosol IDA --
GO:0016020 membrane IDA,IEA 19946888
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with FUT8: view

Pathways & Interactions for FUT8 Gene

genes like me logo Genes that share pathways with FUT8: view

UniProtKB/Swiss-Prot Q9BYC5-FUT8_HUMAN

  • Pathway: Protein modification; protein glycosylation.

Gene Ontology (GO) - Biological Process for FUT8 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001701 in utero embryonic development NAS 11698403
GO:0006486 protein glycosylation IEA --
GO:0006487 protein N-linked glycosylation TAS 9133635
GO:0006491 N-glycan processing TAS 11698403
GO:0007179 transforming growth factor beta receptor signaling pathway IEA --
genes like me logo Genes that share ontologies with FUT8: view

No data available for SIGNOR curated interactions for FUT8 Gene

Drugs & Compounds for FUT8 Gene

(1) Drugs for FUT8 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Guanosine diphosphate Experimental Pharma 0

(4) Additional Compounds for FUT8 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
GDP-L-fucose
  • (6-deoxy-beta-L-galactopyranosyl) ester
  • GDP Fucose
  • GDP-beta-L-Fucose
  • Guanosine diphosphate fucose
  • Guanosine diphosphofucose
15839-70-0
genes like me logo Genes that share compounds with FUT8: view

Transcripts for FUT8 Gene

Unigene Clusters for FUT8 Gene

Fucosyltransferase 8 (alpha (1,6) fucosyltransferase):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for FUT8 Gene

ExUns: 1a · 1b ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d · 6e ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14 ^ 15a · 15b
SP1: - - - - - -
SP2: - - - - - - -
SP3: - - - - - -
SP4: - - - -
SP5: -
SP6: - -
SP7: - -
SP8: - - -
SP9:

Relevant External Links for FUT8 Gene

GeneLoc Exon Structure for
FUT8
ECgene alternative splicing isoforms for
FUT8

Expression for FUT8 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FUT8 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for FUT8 Gene

This gene is overexpressed in Nasal epithelium (36.1), Breast (12.4), and Bone (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FUT8 Gene



NURSA nuclear receptor signaling pathways regulating expression of FUT8 Gene:

FUT8

SOURCE GeneReport for Unigene cluster for FUT8 Gene:

Hs.597649

Evidence on tissue expression from TISSUES for FUT8 Gene

  • Nervous system(4.8)
  • Lung(4.7)
  • Liver(3.3)
  • Pancreas(3)
  • Eye(2.7)
  • Stomach(2.5)
  • Skin(2.3)
  • Intestine(2.2)
genes like me logo Genes that share expression patterns with FUT8: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for FUT8 Gene

Orthologs for FUT8 Gene

This gene was present in the common ancestor of animals.

Orthologs for FUT8 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FUT8 34 35
  • 99.83 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 94 (a)
OneToMany
-- 35
  • 85 (a)
OneToMany
dog
(Canis familiaris)
Mammalia FUT8 34 35
  • 93.62 (n)
cow
(Bos Taurus)
Mammalia FUT8 34 35
  • 93.57 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia FUT8 35
  • 93 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Fut8 34
  • 92.12 (n)
mouse
(Mus musculus)
Mammalia Fut8 34 16 35
  • 91.77 (n)
chicken
(Gallus gallus)
Aves FUT8 34 35
  • 83.48 (n)
lizard
(Anolis carolinensis)
Reptilia FUT8 35
  • 93 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia fut8 34
  • 78.03 (n)
Str.230 34
African clawed frog
(Xenopus laevis)
Amphibia fut8-A 34
zebrafish
(Danio rerio)
Actinopterygii FUT8 (2 of 2) 35
  • 76 (a)
OneToMany
fut8a 34 35
  • 71.77 (n)
Dr.5303 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001888 34
  • 53.15 (n)
fruit fly
(Drosophila melanogaster)
Insecta FucT6 36 34 35
  • 52.7 (n)
worm
(Caenorhabditis elegans)
Secernentea fut-8 34 35
  • 50.61 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 52 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.11077 34
Species where no ortholog for FUT8 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FUT8 Gene

ENSEMBL:
Gene Tree for FUT8 (if available)
TreeFam:
Gene Tree for FUT8 (if available)

Paralogs for FUT8 Gene

No data available for Paralogs for FUT8 Gene

Variants for FUT8 Gene

Sequence variations from dbSNP and Humsavar for FUT8 Gene

SNP ID Clin Chr 14 pos Sequence Context AA Info Type
rs1000008276 -- 65,450,947(+) CGCCT(A/C)CCAGG intron-variant
rs1000009430 -- 65,568,488(+) TCATT(A/T)ATTTA intron-variant, upstream-variant-2KB
rs1000017467 -- 65,710,603(+) AATCT(A/G)TTTTT intron-variant
rs1000021919 -- 65,624,568(+) TTTAC(C/G)TCCTT intron-variant
rs1000025257 -- 65,627,105(+) ATGCT(G/T)ATTTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for FUT8 Gene

Variant ID Type Subtype PubMed ID
esv1385928 CNV deletion 17803354
esv1713819 CNV deletion 17803354
esv2413773 CNV deletion 18987734
esv2659861 CNV deletion 23128226
esv2664690 CNV deletion 23128226
esv2672840 CNV deletion 23128226
esv2677649 CNV deletion 23128226
esv2748779 CNV deletion 23290073
esv2748793 CNV deletion 23290073
esv2748794 CNV deletion 23290073
esv2748795 CNV deletion 23290073
esv2748797 CNV deletion 23290073
esv2748798 CNV deletion 23290073
esv3434438 CNV insertion 20981092
esv3551673 CNV deletion 23714750
esv3551675 CNV deletion 23714750
esv3581230 CNV loss 25503493
esv3581231 CNV loss 25503493
esv3581232 CNV loss 25503493
esv3581233 CNV loss 25503493
esv3634773 CNV loss 21293372
esv3634775 CNV loss 21293372
esv3634776 CNV loss 21293372
nsv1148956 CNV deletion 26484159
nsv456327 CNV loss 19166990
nsv473029 CNV novel sequence insertion 20440878
nsv510639 CNV deletion 20534489
nsv517316 CNV loss 19592680
nsv564951 CNV loss 21841781
nsv7255 OTHER inversion 18451855
nsv832818 CNV gain 17160897
nsv832819 CNV gain 17160897
nsv958781 CNV deletion 24416366
nsv976347 CNV duplication 23825009

Variation tolerance for FUT8 Gene

Residual Variation Intolerance Score: 20.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.29; 81.33% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FUT8 Gene

Human Gene Mutation Database (HGMD)
FUT8
SNPedia medical, phenotypic, and genealogical associations of SNPs for
FUT8

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FUT8 Gene

Disorders for FUT8 Gene

MalaCards: The human disease database

(4) MalaCards diseases for FUT8 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
pancreatic acinar cell adenocarcinoma
  • pancreatic acinar cell carcinoma
smoldering myeloma
leukocyte adhesion deficiency
  • leukocyte adhesion deficiency, type i
recurrent respiratory papillomatosis
  • adult-onset recurrent respiratory papillomatosis
- elite association - COSMIC cancer census association via MalaCards
Search FUT8 in MalaCards View complete list of genes associated with diseases

Relevant External Links for FUT8

Genetic Association Database (GAD)
FUT8
Human Genome Epidemiology (HuGE) Navigator
FUT8
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FUT8
genes like me logo Genes that share disorders with FUT8: view

No data available for UniProtKB/Swiss-Prot and Genatlas for FUT8 Gene

Publications for FUT8 Gene

  1. Crystal structure of mammalian alpha1,6-fucosyltransferase, FUT8. (PMID: 17172260) Ihara H. … Taniguchi N. (Glycobiology 2007) 3 4 22 64
  2. Genomic structure and promoter analysis of the human alpha1,6- fucosyltransferase gene (FUT8). (PMID: 10814706) Yamaguchi Y. … Taniguchi N. (Glycobiology 2000) 3 4 22 64
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  4. Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1I+ as a master regulator of plasma protein fucosylation. (PMID: 21203500) Lauc G. … Rudan I. (PLoS Genet. 2010) 3 46 64
  5. Core fucosylation of E-cadherin enhances cell-cell adhesion in human colon carcinoma WiDr cells. (PMID: 19302290) Osumi D. … Taniguchi N. (Cancer Sci. 2009) 3 22 64

Products for FUT8 Gene

Sources for FUT8 Gene

Content
Loading form....