Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FOLH1 Gene

Aliases for FOLH1 Gene

  • Folate Hydrolase 1 2 3 4 5
  • N-Acetylated-Alpha-Linked Acidic Dipeptidase I 3 4
  • Pteroylpoly-Gamma-Glutamate Carboxypeptidase 3 4
  • Folylpoly-Gamma-Glutamate Carboxypeptidase 3 4
  • Cell Growth-Inhibiting Gene 27 Protein 3 4
  • Membrane Glutamate Carboxypeptidase 3 4
  • Glutamate Carboxypeptidase II 3 4
  • Glutamate Carboxypeptidase 2 2 3
  • Glutamate Carboxylase II 2 3
  • EC 3.4.17.21 4 61
  • NAALADase I 3 4
  • NAALAD1 3 4
  • GCPII 3 4
  • FOLH 3 4
  • FGCP 3 4
  • PSMA 3 4
  • MGCP 3 4
  • PSM 3 4
  • Folate Hydrolase (Prostate-Specific Membrane Antigen) 1 2
  • N-Acetylated Alpha-Linked Acidic Dipeptidase 1 3
  • Prostate Specific Membrane Antigen Variant F 3
  • Prostate-Specific Membrane Antigen 4
  • NAALAdase 3
  • GCP2 3

External Ids for FOLH1 Gene

Previous HGNC Symbols for FOLH1 Gene

  • FOLH

Previous GeneCards Identifiers for FOLH1 Gene

  • GC11M051274
  • GC11M050361
  • GC11M049199
  • GC11M049132
  • GC11M049124
  • GC11M048888
  • GC11M049168
  • GC11M049596
  • GC11M049622
  • GC11M050827
  • GC11M051622
  • GC11M052284

Summaries for FOLH1 Gene

Entrez Gene Summary for FOLH1 Gene

  • This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq, Jul 2010]

GeneCards Summary for FOLH1 Gene

FOLH1 (Folate Hydrolase 1) is a Protein Coding gene. Diseases associated with FOLH1 include Hyperhomocysteinemia and Prostate Cancer. Among its related pathways are Amino acid synthesis and interconversion (transamination) and Circadian entrainment. GO annotations related to this gene include peptidase activity and carboxypeptidase activity. An important paralog of this gene is NAALAD2.

UniProtKB/Swiss-Prot for FOLH1 Gene

  • Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.

  • Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.

Tocris Summary for FOLH1 Gene

  • Carboxypeptidases are a group of enzymes that cleave amino acids from the C'-terminal of proteins and peptides by hydrolysis. There are three subgroups; serine-type carboxypeptidases, metallocarboxypeptidases, and cysteine-type carboxypeptidases.

Gene Wiki entry for FOLH1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FOLH1 Gene

Genomics for FOLH1 Gene

Regulatory Elements for FOLH1 Gene

Enhancers for FOLH1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH11G049166 0.6 dbSUPER 36.5 +36.4 36420 10.7 CTCF SOX13 ZNF654 RAD21 POLR2A SMARCA4 SMC3 CREB1 NFE2 HNF4A FOLH1 GTF2IP11 UBTFL9
GH11G049206 0.8 ENCODE dbSUPER 24.4 +0.6 639 2.5 CTCF ZNF654 ESRRA TAF1 HNF4A RAD21 YY1 FOLH1 UBTFL9
GH11G049183 0.6 dbSUPER 25.6 +19.8 19757 11.6 SOX5 SOX13 TAF1 RAD21 YY1 SMARCA4 POLR2A HNF4A EZH2 FOLH1 UBTFL9
GH11G049226 0.6 dbSUPER 22 -20.9 -20872 5.2 CTCF ZNF654 ESRRA SMC3 CREB1 RAD21 FOLH1 LOC440040 LOC729960
GH11G049178 0.5 ENCODE 23.9 +30.5 30527 0.2 CTBP1 CREB1 DPF2 FOLH1 UBTFL9
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FOLH1 on UCSC Golden Path with GeneCards custom track

Promoters for FOLH1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000039804 169 999 ESRRA TAF1 HNF4A RAD21 YY1

Genomic Location for FOLH1 Gene

Chromosome:
11
Start:
49,146,635 bp from pter
End:
49,208,670 bp from pter
Size:
62,036 bases
Orientation:
Minus strand

Genomic View for FOLH1 Gene

Genes around FOLH1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FOLH1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FOLH1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FOLH1 Gene

Proteins for FOLH1 Gene

  • Protein details for FOLH1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q04609-FOLH1_HUMAN
    Recommended name:
    Glutamate carboxypeptidase 2
    Protein Accession:
    Q04609
    Secondary Accessions:
    • A4UU12
    • A9CB79
    • B7Z312
    • B7Z343
    • D3DQS5
    • E9PDX8
    • O43748
    • Q16305
    • Q541A4
    • Q8TAY3
    • Q9NP15
    • Q9NYE2
    • Q9P1P8

    Protein attributes for FOLH1 Gene

    Size:
    750 amino acids
    Molecular mass:
    84331 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Homodimer.
    Miscellaneous:
    • PSMA is used as a diagnostic and prognostic indicator of prostate cancer, and as a possible marker for various neurological disorders such as schizophrenia, Alzheimer disease and Huntington disease.
    SequenceCaution:
    • Sequence=AAF31167.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for FOLH1 Gene

    Alternative splice isoforms for FOLH1 Gene

neXtProt entry for FOLH1 Gene

Selected DME Specific Peptides for FOLH1 Gene

Q04609:
  • EPDRYVILGGHRD
  • IEGNYTLRVDCTPL
  • ILYSDPADYF
  • LERAFIDPLGLP
  • SFDSLFSAV
  • PRISKLGSGNDFEVFFQRLGIASGRARYTK

Post-translational modifications for FOLH1 Gene

  • The first two amino acids at the N-terminus of isoform PSMA appear to be cleaved by limited proteolysis.
  • The N-terminus is blocked.
  • Glycosylation at isoforms=7, 8, 951, Asn76, isoforms=6, 7, 8, 9121, isoforms=6, 7, 8, 9140, Asn153, isoforms=6, 4, 7, 8, 9195, Asn336, Asn459, isoforms=10, 6, 7, 8, 9476, and Asn638
  • Modification sites at PhosphoSitePlus

Domains & Families for FOLH1 Gene

Gene Families for FOLH1 Gene

Suggested Antigen Peptide Sequences for FOLH1 Gene

Graphical View of Domain Structure for InterPro Entry

Q04609

UniProtKB/Swiss-Prot:

FOLH1_HUMAN :
  • The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
  • Belongs to the peptidase M28 family. M28B subfamily.
Domain:
  • The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
Family:
  • Belongs to the peptidase M28 family. M28B subfamily.
genes like me logo Genes that share domains with FOLH1: view

Function for FOLH1 Gene

Molecular function for FOLH1 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
pH dependence: Stable at pH greater than 6.5.;
UniProtKB/Swiss-Prot CatalyticActivity:
Release of an unsubstituted, C-terminal glutamyl residue, typically from Ac-Asp-Glu or folylpoly-gamma-glutamates.
UniProtKB/Swiss-Prot EnzymeRegulation:
The NAALADase activity is inhibited by beta-NAAG, quisqualic acid, 2-(phosphonomethyl) pentanedioic acid (PMPA) and EDTA. Activated by cobalt.
UniProtKB/Swiss-Prot Function:
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.
UniProtKB/Swiss-Prot Function:
Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
UniProtKB/Swiss-Prot Induction:
In the prostate, up-regulated in response to androgen deprivation.

Enzyme Numbers (IUBMB) for FOLH1 Gene

Gene Ontology (GO) - Molecular Function for FOLH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004180 carboxypeptidase activity IEA --
GO:0004181 metallocarboxypeptidase activity IDA 12949938
GO:0008233 peptidase activity NAS 9375657
GO:0008237 metallopeptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with FOLH1: view
genes like me logo Genes that share phenotypes with FOLH1: view

Animal Model Products

CRISPR Products

miRNA for FOLH1 Gene

miRTarBase miRNAs that target FOLH1

Clone Products

  • Addgene plasmids for FOLH1

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for FOLH1 Gene

Localization for FOLH1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FOLH1 Gene

Cell membrane; Single-pass type II membrane protein.
Isoform PSMA: Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FOLH1 gene
Compartment Confidence
plasma membrane 5
extracellular 5
cytoskeleton 2
nucleus 2
cytosol 2
endosome 2
mitochondrion 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for FOLH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane TAS --
GO:0005887 integral component of plasma membrane TAS,IEA --
GO:0009986 cell surface IDA 12949938
GO:0016020 membrane TAS,NAS 9375657
genes like me logo Genes that share ontologies with FOLH1: view

Pathways & Interactions for FOLH1 Gene

genes like me logo Genes that share pathways with FOLH1: view

Interacting Proteins for FOLH1 Gene

Gene Ontology (GO) - Biological Process for FOLH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IDA,NAS 9375657
GO:0006760 folic acid-containing compound metabolic process IEA --
GO:0008152 metabolic process IEA --
GO:0008652 cellular amino acid biosynthetic process TAS --
GO:0035609 C-terminal protein deglutamylation IDA 12949938
genes like me logo Genes that share ontologies with FOLH1: view

No data available for SIGNOR curated interactions for FOLH1 Gene

Drugs & Compounds for FOLH1 Gene

(31) Drugs for FOLH1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Capromab Approved Pharma antibody, Target, other/unknown 0
Docetaxel Approved May 1996, Investigational Pharma Inhibition, inhibitor, Biomarker Microtubulin disassembly inhibitor, Tubulin and VEGF inhibitor, Taxanes, Microtubule stabilizer 1967
Methotrexate Approved Pharma Folate antagonist,inhibits DFHR 1551
Mercaptopurine Approved Pharma 0
(2S)-2-{[HYDROXY(4-IODOBENZYL)PHOSPHORYL]METHYL}PENTANEDIOIC ACID Experimental Pharma Target 0

(22) Additional Compounds for FOLH1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(2) Tocris Compounds for FOLH1 Gene

Compound Action Cas Number
2-MPPA Selective glutamate carboxypeptidase II (GCP II) inhibitor; orally bioavailable 254737-29-6
PMPA (NAALADase inhibitor) GCP II inhibitor 173039-10-6

(3) ApexBio Compounds for FOLH1 Gene

Compound Action Cas Number
2-MPPA 254737-29-6
PMPA (NAALADase inhibitor) Glutamate carboxypeptidase 2 inhibitor 173039-10-6
ZJ 43 GCP II and III/NAAG peptidase/NAALADase inhibitor 723331-20-2
genes like me logo Genes that share compounds with FOLH1: view

Drug Products

Transcripts for FOLH1 Gene

Unigene Clusters for FOLH1 Gene

Folate hydrolase (prostate-specific membrane antigen) 1:
Representative Sequences:

CRISPR Products

Clone Products

  • Addgene plasmids for FOLH1

Alternative Splicing Database (ASD) splice patterns (SP) for FOLH1 Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7a · 7b ^ 8a · 8b ^ 9
SP1: - - - - - -
SP2: - - - -
SP3: - - - - - - - -
SP4: - - - -
SP5: - - -
SP6: - - -

Relevant External Links for FOLH1 Gene

GeneLoc Exon Structure for
FOLH1
ECgene alternative splicing isoforms for
FOLH1

Expression for FOLH1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FOLH1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for FOLH1 Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x9.8), Prostate (x7.3), Brain - Substantia nigra (x5.7), and Brain - Hippocampus (x4.3).

Protein differential expression in normal tissues from HIPED for FOLH1 Gene

This gene is overexpressed in Pancreatic juice (18.5), Fetal gut (16.9), Salivary gland (9.2), and Platelet (8.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FOLH1 Gene



NURSA nuclear receptor signaling pathways regulating expression of FOLH1 Gene:

FOLH1

SOURCE GeneReport for Unigene cluster for FOLH1 Gene:

Hs.654487

mRNA Expression by UniProt/SwissProt for FOLH1 Gene:

Q04609-FOLH1_HUMAN
Tissue specificity: Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kidney, liver, spleen, colon, trachea, spinal cord and the capillary endothelium of a variety of tumors. Expressed specifically in jejunum brush border membranes. In the brain, highly expressed in the ventral striatum and brain stem. Also expressed in fetal liver and kidney. Isoform PSMA is the most abundant form in normal prostate. Isoform PSMA-1 is the most abundant form in primary prostate tumors. Isoform PSMA-3 is also found in normal prostate as well as in brain and liver. Isoform PSMA-9 is specifically expressed in prostate cancer.

Evidence on tissue expression from TISSUES for FOLH1 Gene

  • Nervous system(4.8)
  • Intestine(4.6)
  • Liver(4.5)
  • Lung(4.3)
  • Kidney(2.8)
  • Blood(2.1)
  • Lymph node(2.1)
genes like me logo Genes that share expression patterns with FOLH1: view

Primer Products

No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for FOLH1 Gene

Orthologs for FOLH1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for FOLH1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FOLH1 34 35
  • 99.16 (n)
dog
(Canis familiaris)
Mammalia FOLH1 35
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia FOLH1 35
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Folh1 35
  • 85 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia FOLH1 35
  • 79 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia FOLH1 35
  • 77 (a)
OneToOne
chicken
(Gallus gallus)
Aves FOLH1 35
  • 74 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia FOLH1 35
  • 72 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia Str.8739 34
zebrafish
(Danio rerio)
Actinopterygii naalad2 35
  • 66 (a)
OneToMany
zgc56429 34
worm
(Caenorhabditis elegans)
Secernentea C35C5.2 36
  • 32 (a)
gcp-2.1 35
  • 32 (a)
ManyToMany
gcp-2.2 35
  • 29 (a)
ManyToMany
gcp-2.3 35
  • 28 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes VPS70 35
  • 22 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 44 (a)
ManyToMany
-- 35
  • 44 (a)
ManyToMany
-- 35
  • 37 (a)
ManyToMany
-- 35
  • 37 (a)
ManyToMany
Species where no ortholog for FOLH1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FOLH1 Gene

ENSEMBL:
Gene Tree for FOLH1 (if available)
TreeFam:
Gene Tree for FOLH1 (if available)

Paralogs for FOLH1 Gene

Paralogs for FOLH1 Gene

(4) SIMAP similar genes for FOLH1 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with FOLH1: view

Variants for FOLH1 Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for FOLH1 Gene

FOLH1_HUMAN-Q04609
Genetic variation in FOLH1 may be associated with low folate levels and consequent hyperhomocysteinemia. This condition can result in increased risk of cardiovascular disease, neural tube defects, and cognitive deficits.

Sequence variations from dbSNP and Humsavar for FOLH1 Gene

SNP ID Clin Chr 11 pos Sequence Context AA Info Type
VAR_036398 A colorectal cancer sample
rs79155991 Benign 49,186,767(+) AGATC(A/G)CCCTG nc-transcript-variant, reference, synonymous-codon, utr-variant-5-prime
rs1000202032 -- 49,170,981(+) GACAT(C/T)AAGTG intron-variant
rs1000360408 -- 49,177,490(+) AGCAG(A/T)TAATG intron-variant
rs1000467076 -- 49,183,593(+) ATATT(A/G)GCCAA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for FOLH1 Gene

Variant ID Type Subtype PubMed ID
esv2666171 CNV deletion 23128226
esv2744485 CNV deletion 23290073
esv2759824 CNV gain+loss 17122850
esv2759825 CNV gain+loss 17122850
esv3891984 CNV gain 25118596
esv3891986 CNV gain 25118596
esv3891995 CNV gain 25118596
esv3891996 CNV gain 25118596
nsv1044070 CNV loss 25217958
nsv467874 CNV gain 19166990
nsv469956 CNV gain 18288195
nsv518571 CNV gain 19592680
nsv525454 CNV loss 19592680
nsv554223 CNV gain 21841781
nsv554347 CNV gain 21841781
nsv832145 CNV gain 17160897
nsv972015 CNV duplication 23825009
nsv975176 CNV duplication 23825009

Variation tolerance for FOLH1 Gene

Residual Variation Intolerance Score: 52.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 8.81; 86.85% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FOLH1 Gene

Human Gene Mutation Database (HGMD)
FOLH1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
FOLH1

Disorders for FOLH1 Gene

MalaCards: The human disease database

(15) MalaCards diseases for FOLH1 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hyperhomocysteinemia
prostate cancer
  • prostate cancer, hereditary, 5
prostate disease
  • prostate diseases
prostate adenocarcinoma
  • adenocarcinoma of prostate
male reproductive organ cancer
  • male genital cancer
- elite association - COSMIC cancer census association via MalaCards
Search FOLH1 in MalaCards View complete list of genes associated with diseases

Relevant External Links for FOLH1

Genetic Association Database (GAD)
FOLH1
Human Genome Epidemiology (HuGE) Navigator
FOLH1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FOLH1
genes like me logo Genes that share disorders with FOLH1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for FOLH1 Gene

Publications for FOLH1 Gene

  1. Glutamate carboxypeptidase II: a polymorphism associated with lower levels of serum folate and hyperhomocysteinemia. (PMID: 11092759) Devlin A.M. … Halsted C.H. (Hum. Mol. Genet. 2000) 3 4 22 46 64
  2. Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene. (PMID: 9838072) O'Keefe D.S. … Heston W.D.W. (Biochim. Biophys. Acta 1998) 2 3 4 22 64
  3. Reaction mechanism of glutamate carboxypeptidase II revealed by mutagenesis, X-ray crystallography, and computational methods. (PMID: 19301871) Klusak V. … Lubkowski J. (Biochemistry 2009) 3 4 22 64
  4. Genetic and environmental influences on total plasma homocysteine and coronary artery disease (CAD) risk among South Indians. (PMID: 19394322) Vinukonda G. … Rama Devi Akella R. (Clin. Chim. Acta 2009) 3 22 46 64
  5. Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs. (PMID: 18234225) Barinka C. … Lubkowski J. (J. Mol. Biol. 2008) 3 4 22 64

Products for FOLH1 Gene

  • Addgene plasmids for FOLH1

Sources for FOLH1 Gene

Content
Loading form....