Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FNTB Gene

Aliases for FNTB Gene

  • Farnesyltransferase, CAAX Box, Beta 2 3 5
  • Ras Proteins Prenyltransferase Subunit Beta 3 4
  • CAAX Farnesyltransferase Subunit Beta 3 4
  • EC 2.5.1.58 4 61
  • FTase-Beta 3 4
  • Protein Farnesyltransferase Subunit Beta 3
  • FPTB 3

External Ids for FNTB Gene

Previous GeneCards Identifiers for FNTB Gene

  • GC14P062781
  • GC14P059247
  • GC14P063443
  • GC14P064523
  • GC14P065381
  • GC14P065454

Summaries for FNTB Gene

GeneCards Summary for FNTB Gene

FNTB (Farnesyltransferase, CAAX Box, Beta) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and G-protein signaling_H-RAS regulation pathway. GO annotations related to this gene include drug binding and farnesyltranstransferase activity. An important paralog of this gene is CHURC1-FNTB.

UniProtKB/Swiss-Prot for FNTB Gene

  • Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Gene Wiki entry for FNTB Gene

No data available for Entrez Gene Summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FNTB Gene

Genomics for FNTB Gene

Regulatory Elements for FNTB Gene

Enhancers for FNTB Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH14F065042 1.2 Ensembl ENCODE 14.8 +57.2 57153 3.1 PKNOX1 ATF1 ARNT ELK1 GATA2 NCOA1 MBD2 SMARCA4 MYNN NBN FNTB CHURC1-FNTB CHURC1 MIR4706 PIR35799
GH14F065019 1 Ensembl ENCODE 14.6 +33.4 33382 0.6 SOX13 CTCF TFAP4 SAP130 ARID4B RAD21 ZNF143 SMC3 HOMEZ THAP11 FNTB CHURC1-FNTB GPX2 PIR35799 MIR4706
GH14F065047 0.8 Ensembl ENCODE 14.8 +61.3 61331 1.9 OSR2 FEZF1 KDM1A ZNF843 FNTB CHURC1-FNTB MIR4706 PIR44037
GH14F065005 0.8 ENCODE 14.7 +19.7 19652 1.5 INSM2 KLF17 FEZF1 HIC1 ZNF366 PATZ1 NFE2 FOS FOSL2 GFI1B CHURC1 FNTB CHURC1-FNTB GPX2 RPPH1-2P ENSG00000272158 PIR35799
GH14F065035 0.6 ENCODE 15.3 +48.5 48518 0.2 E2F1 HNF4G ZBTB33 RAD21 NR2F2 YY1 FNTB CHURC1-FNTB MIR4706 PIR35799
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FNTB on UCSC Golden Path with GeneCards custom track

Promoters for FNTB Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001458110 680 2001 HDGF PKNOX1 ARNT CREB3L1 MLX WRNIP1 ZFP64 ARID4B SIN3A DMAP1

Genomic Location for FNTB Gene

Chromosome:
14
Start:
64,986,720 bp from pter
End:
65,062,652 bp from pter
Size:
75,933 bases
Orientation:
Plus strand

Genomic View for FNTB Gene

Genes around FNTB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FNTB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FNTB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FNTB Gene

Proteins for FNTB Gene

  • Protein details for FNTB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P49356-FNTB_HUMAN
    Recommended name:
    Protein farnesyltransferase subunit beta
    Protein Accession:
    P49356
    Secondary Accessions:
    • B2RDX6
    • B4E1A0

    Protein attributes for FNTB Gene

    Size:
    437 amino acids
    Molecular mass:
    48774 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Heterodimer of FNTA and FNTB.

    Three dimensional structures from OCA and Proteopedia for FNTB Gene

    Alternative splice isoforms for FNTB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FNTB Gene

Selected DME Specific Peptides for FNTB Gene

P49356:
  • RERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRL
  • YHTCYCL
  • NKLVDGCY
  • EAHGGYT
  • CPPSSSP
  • FLQKPVPGFEE
  • WMFHQQALQEYILMCCQCP

Post-translational modifications for FNTB Gene

  • Ubiquitination at Lys 63
  • Modification sites at PhosphoSitePlus

Other Protein References for FNTB Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • Abcam antibodies for FNTB
  • Santa Cruz Biotechnology (SCBT) Antibodies for FNTB

Domains & Families for FNTB Gene

Protein Domains for FNTB Gene

Graphical View of Domain Structure for InterPro Entry

P49356

UniProtKB/Swiss-Prot:

FNTB_HUMAN :
  • Belongs to the protein prenyltransferase subunit beta family.
  • Contains 5 PFTB repeats.
Family:
  • Belongs to the protein prenyltransferase subunit beta family.
Similarity:
  • Contains 5 PFTB repeats.
genes like me logo Genes that share domains with FNTB: view

No data available for Gene Families for FNTB Gene

Function for FNTB Gene

Molecular function for FNTB Gene

GENATLAS Biochemistry:
CAAX farnesyltransferase,beta subunit,promoting the prenylation of Ras,first step of a series of post translational modification of RAS,required for its association with the inner surface of the plasma membrane,also involved in maturation of other proteins including Ras family members,the gamma subunit of G proteins and nuclear lamins
UniProtKB/Swiss-Prot CatalyticActivity:
Farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
UniProtKB/Swiss-Prot Function:
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.

Enzyme Numbers (IUBMB) for FNTB Gene

Gene Ontology (GO) - Molecular Function for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004311 farnesyltranstransferase activity IEA --
GO:0004659 prenyltransferase activity IEA --
GO:0004660 contributes_to protein farnesyltransferase activity IEA,IDA 19228685
GO:0005515 protein binding IPI 11687658
GO:0008144 drug binding IEA --
genes like me logo Genes that share ontologies with FNTB: view
genes like me logo Genes that share phenotypes with FNTB: view

Animal Models for FNTB Gene

MGI Knock Outs for FNTB:

Animal Model Products

  • Taconic Biosciences Mouse Models for FNTB

miRNA for FNTB Gene

miRTarBase miRNAs that target FNTB

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for FNTB

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FNTB Gene

Localization for FNTB Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FNTB gene
Compartment Confidence
cytoskeleton 4
cytosol 4

Gene Ontology (GO) - Cellular Components for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005829 cytosol TAS --
GO:0005875 microtubule associated complex IDA 19228685
GO:0005965 protein farnesyltransferase complex IDA 16893176
GO:0043234 protein complex IEA --
genes like me logo Genes that share ontologies with FNTB: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for FNTB Gene

Pathways & Interactions for FNTB Gene

genes like me logo Genes that share pathways with FNTB: view

Gene Ontology (GO) - Biological Process for FNTB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008284 positive regulation of cell proliferation IEA --
GO:0008285 negative regulation of cell proliferation IEA --
GO:0010035 response to inorganic substance IEA --
GO:0014070 response to organic cyclic compound IEA --
GO:0018343 protein farnesylation IDA 16893176
genes like me logo Genes that share ontologies with FNTB: view

No data available for SIGNOR curated interactions for FNTB Gene

Drugs & Compounds for FNTB Gene

(18) Drugs for FNTB Gene - From: DrugBank, PharmGKB, ApexBio, and DGIdb

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carboplatin Approved Pharma Antitumor agent that forms platinum-DNA adducts., Platinum 1980
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 2758
(11S)-8-CHLORO-11-[1-(METHYLSULFONYL)PIPERIDIN-4-YL]-6-PIPERAZIN-1-YL-11H-BENZO[5,6]CYCLOHEPTA[1,2-B]PYRIDINE Experimental Pharma Target 0
(20S)-19,20,21,22-TETRAHYDRO-19-OXO-5H-18,20-ETHANO-12,14-ETHENO-6,10-METHENO-18H-BENZ[D]IMIDAZO[4,3-K][1,6,9,12]OXATRIAZA-CYCLOOCTADECOSINE-9-CARBONITRILE Experimental Pharma Target 0
(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIAZACYCLONOADECOSINE-9-CARBONITRILE Experimental Pharma Target 0

(2) Additional Compounds for FNTB Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Farnesyl pyrophosphate
  • (2E,6E)-Farnesyl diphosphate
  • (2E,6E)-Farnesyl pyrophosphate
  • (all-E)-Farnesyl diphosphate
  • (E,E)-Farnesyl diphosphate
  • (E,E)-Farnesyl pyrophosphate
13058-04-3
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8

(4) ApexBio Compounds for FNTB Gene

Compound Action Cas Number
FTI 277 HCl FTase inhibitor 180977-34-8
LB42708 Selective FTase inhibitor 226929-39-1
Lonafarnib Ftase inhibitor,potent and selective 193275-84-2
Tipifarnib (Zarnestra) Farnesyltransferase inhibitor,potent and specific 192185-72-1
genes like me logo Genes that share compounds with FNTB: view

Transcripts for FNTB Gene

Unigene Clusters for FNTB Gene

Farnesyltransferase, CAAX box, beta:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for FNTB

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for FNTB Gene

No ASD Table

Relevant External Links for FNTB Gene

GeneLoc Exon Structure for
FNTB
ECgene alternative splicing isoforms for
FNTB

Expression for FNTB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FNTB Gene

mRNA differential expression in normal tissues according to GTEx for FNTB Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FNTB Gene



Protein tissue co-expression partners for FNTB Gene

NURSA nuclear receptor signaling pathways regulating expression of FNTB Gene:

FNTB

SOURCE GeneReport for Unigene cluster for FNTB Gene:

Hs.325531
genes like me logo Genes that share expression patterns with FNTB: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for FNTB Gene

Orthologs for FNTB Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for FNTB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FNTB 35
  • 100 (a)
OneToOne
dog
(Canis familiaris)
Mammalia FNTB 34 35
  • 93.04 (n)
cow
(Bos Taurus)
Mammalia FNTB 34
  • 92.07 (n)
mouse
(Mus musculus)
Mammalia Fntb 34 16 35
  • 90.16 (n)
rat
(Rattus norvegicus)
Mammalia Fntb 34
  • 89.63 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 86 (a)
OneToMany
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 69 (a)
OneToMany
chicken
(Gallus gallus)
Aves -- 35
  • 84 (a)
OneToMany
FNTB 34
  • 76.25 (n)
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 80 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia fntb 34
  • 69.58 (n)
zebrafish
(Danio rerio)
Actinopterygii fntb 34 35
  • 68.92 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001729 34
  • 57.33 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG17565 36 34 35
  • 57.27 (n)
worm
(Caenorhabditis elegans)
Secernentea fntb-1 34 35
  • 50.72 (n)
F23B12.6 36
  • 46 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RAM1 35 37
  • 36 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons ERA1 34
  • 54.25 (n)
rice
(Oryza sativa)
Liliopsida Os01g0737800 34
  • 56.13 (n)
Os.20991 34
wheat
(Triticum aestivum)
Liliopsida Ta.7380 34
corn
(Zea mays)
Liliopsida Zm.14070 34
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 54 (a)
OneToMany
Species where no ortholog for FNTB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for FNTB Gene

ENSEMBL:
Gene Tree for FNTB (if available)
TreeFam:
Gene Tree for FNTB (if available)

Paralogs for FNTB Gene

Paralogs for FNTB Gene

(3) SIMAP similar genes for FNTB Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with FNTB: view

Variants for FNTB Gene

Sequence variations from dbSNP and Humsavar for FNTB Gene

SNP ID Clin Chr 14 pos Sequence Context AA Info Type
rs10130037 -- 65,054,388(+) TATGG(A/G)TGTGA intron-variant
rs10130343 -- 65,062,169(+) TTTCT(A/T)TCTTT intron-variant, utr-variant-3-prime
rs10134609 -- 65,051,035(+) AAGGA(A/G)GGGAA intron-variant
rs10135220 -- 65,059,334(+) GCCCC(C/T)TTTTT intron-variant
rs10142987 -- 65,058,270(+) ttttc(A/G)gttag intron-variant

Structural Variations from Database of Genomic Variants (DGV) for FNTB Gene

Variant ID Type Subtype PubMed ID
nsv832816 CNV gain 17160897
nsv1108903 CNV deletion 24896259
nsv1070225 CNV deletion 25765185
esv3551663 CNV deletion 23714750
esv2748787 CNV deletion 23290073
esv2748779 CNV deletion 23290073
esv2665422 CNV deletion 23128226
esv2506970 CNV deletion 19546169

Variation tolerance for FNTB Gene

Residual Variation Intolerance Score: 28.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.35; 7.84% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FNTB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FNTB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FNTB Gene

Disorders for FNTB Gene

Relevant External Links for FNTB

Genetic Association Database (GAD)
FNTB
Human Genome Epidemiology (HuGE) Navigator
FNTB
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FNTB

No disorders were found for FNTB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FNTB Gene

Publications for FNTB Gene

  1. cDNA cloning of the two subunits of human CAAX farnesyltransferase and chromosomal mapping of FNTA and FNTB loci and related sequences. (PMID: 8276393) Andres D.A. … Francke U. (Genomics 1993) 2 3 4 64
  2. Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study. (PMID: 19841875) Fontaine-Bisson B. … Morange P.E. (J. Mol. Med. 2010) 3 46 64
  3. Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium. (PMID: 19862010) Ganesh S.K. … Lin J.P. (Nat. Genet. 2009) 3 46 64
  4. Conversion of protein farnesyltransferase to a geranylgeranyltransferase. (PMID: 16893176) Terry K.L. … Beese L.S. (Biochemistry 2006) 3 4 64
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64

Products for FNTB Gene

Sources for FNTB Gene

Content
Loading form....