Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FMO2 Gene

Aliases for FMO2 Gene

  • Flavin Containing Monooxygenase 2 2 3 5
  • Flavin Containing Monooxygenase 2 (Non-Functional) 2 3
  • Pulmonary Flavin-Containing Monooxygenase 2 3 4
  • Dimethylaniline Oxidase 2 3 4
  • EC 1.14.13.8 4 61
  • Dimethylaniline Monooxygenase [N-Oxide-Forming] 2 3
  • FMO, Pulmonary 3
  • FMO 1B1 4
  • FMO1B1 3
  • FMO 2 4

External Ids for FMO2 Gene

Previous GeneCards Identifiers for FMO2 Gene

  • GC01P168718
  • GC01P166783
  • GC01P167735
  • GC01P168393
  • GC01P167886
  • GC01P169420
  • GC01P142377

Summaries for FMO2 Gene

Entrez Gene Summary for FMO2 Gene

  • This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

GeneCards Summary for FMO2 Gene

FMO2 (Flavin Containing Monooxygenase 2) is a Protein Coding gene. Diseases associated with FMO2 include Trimethylaminuria. Among its related pathways are Drug metabolism - cytochrome P450 and Busulfan Pathway, Pharmacodynamics. GO annotations related to this gene include oxidoreductase activity and monooxygenase activity. An important paralog of this gene is FMO1.

UniProtKB/Swiss-Prot for FMO2 Gene

  • Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.

Gene Wiki entry for FMO2 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FMO2 Gene

Genomics for FMO2 Gene

Regulatory Elements for FMO2 Gene

Enhancers for FMO2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G171217 1.3 FANTOM5 Ensembl ENCODE 24.1 +35.4 35350 5.3 CTCF TEAD4 RBBP5 CHD7 RAD21 POLR2A SMC3 MAFK MIXL1 ZNF654 FMO2 ENSG00000231424 FMO3 MROH9 ENSG00000225243
GH01G171247 1.4 Ensembl ENCODE dbSUPER 22.3 +68.3 68328 11.9 NFIB ZSCAN4 BMI1 RAD21 GLIS2 SCRT2 FOS MIXL1 EGR2 ZNF654 FMO2 FMO4 FMO1 ENSG00000231424 ENSG00000206692 GC01M171253 LOC105371611
GH01G171209 0.6 ENCODE 26.6 +25.5 25528 1.5 JUND MAX HNF4A ZBTB33 WT1 RAD21 FOXA1 FMO2 ENSG00000225243
GH01G171194 0.7 ENCODE 10.7 +10.7 10713 1.9 ELF3 FOXA2 MLX MAX RAD21 YY1 HNF4G SOX5 TEAD1 HMG20A FMO2 FMO3 ENSG00000225243
GH01G171165 0.5 ENCODE 11 -18.7 -18699 2.7 MAFF ZNF316 MAFG EMSY MAFK FMO2 FMO3 FMO6P
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FMO2 on UCSC Golden Path with GeneCards custom track

Genomic Location for FMO2 Gene

Chromosome:
1
Start:
171,185,208 bp from pter
End:
171,212,683 bp from pter
Size:
27,476 bases
Orientation:
Plus strand

Genomic View for FMO2 Gene

Genes around FMO2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FMO2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FMO2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FMO2 Gene

Proteins for FMO2 Gene

  • Protein details for FMO2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q99518-FMO2_HUMAN
    Recommended name:
    Dimethylaniline monooxygenase [N-oxide-forming] 2
    Protein Accession:
    Q99518
    Secondary Accessions:
    • Q5EBX4
    • Q86U73
    • Q9BRX1

    Protein attributes for FMO2 Gene

    Size:
    471 amino acids
    Molecular mass:
    53644 Da
    Cofactor:
    Name=FAD; Xref=ChEBI:CHEBI:57692;
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    No Data Available

neXtProt entry for FMO2 Gene

Selected DME Specific Peptides for FMO2 Gene

Q99518:
  • DIIKRNE
  • FKGQYFHSRQYKHP
  • NMVSLYKY
  • TNTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFR
  • TQKQRILKPLKTR
  • SEDGYPWD
  • WRFKENVEDGRASIY
  • QSQTLQT
  • NHENYGL
  • VFDAVMVC
  • QSNGKEQ
  • PDFSSSGQW
  • FEDGTVEE
  • WEGARNAI
  • GPGQWEGAR
  • FDLLKYI
  • VKWMIEQQMN
  • FATGYSF
  • CVDEGLEPTCFERTEDIGG
  • MKEPVLNDD
  • FLEDSLVKVE
  • TRVFKGLC
  • LLKYIQF
  • GRASIYQSV
  • DYLDELALEIGAKPD
  • SMLRNVLPR
  • GNSGSDIAVELS
  • AVFDAVM
  • RNEKRIDLFG
  • FKDPKLAV
  • GLIQPLG
  • FGPCNSYQYRL
  • SLYKYIFP
  • VSFLLKILGL

Post-translational modifications for FMO2 Gene

Other Protein References for FMO2 Gene

Domains & Families for FMO2 Gene

Suggested Antigen Peptide Sequences for FMO2 Gene

Graphical View of Domain Structure for InterPro Entry

Q99518

UniProtKB/Swiss-Prot:

FMO2_HUMAN :
  • Belongs to the FMO family.
Family:
  • Belongs to the FMO family.
genes like me logo Genes that share domains with FMO2: view

No data available for Gene Families for FMO2 Gene

Function for FMO2 Gene

Molecular function for FMO2 Gene

GENATLAS Biochemistry:
flavin containing monooxygenase 2,microsomal,pulmonary,protein catalyzing the N-oxidation of primary alkylamines
UniProtKB/Swiss-Prot CatalyticActivity:
N,N-dimethylaniline + NADPH + O(2) = N,N-dimethylaniline N-oxide + NADP(+) + H(2)O.
UniProtKB/Swiss-Prot Function:
Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.

Enzyme Numbers (IUBMB) for FMO2 Gene

Gene Ontology (GO) - Molecular Function for FMO2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004497 monooxygenase activity TAS --
GO:0004499 N,N-dimethylaniline monooxygenase activity IDA,IEA 11744609
GO:0016491 oxidoreductase activity IEA --
GO:0050660 flavin adenine dinucleotide binding IEA --
GO:0050661 NADP binding IEA --
genes like me logo Genes that share ontologies with FMO2: view

Phenotypes for FMO2 Gene

GenomeRNAi human phenotypes for FMO2:
genes like me logo Genes that share phenotypes with FMO2: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for FMO2 Gene

Localization for FMO2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FMO2 Gene

Microsome membrane. Endoplasmic reticulum membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FMO2 gene
Compartment Confidence
endoplasmic reticulum 5
cytosol 3
peroxisome 2
extracellular 1
lysosome 1
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for FMO2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane TAS --
GO:0016020 membrane IEA,IDA 9804831
GO:0016021 integral component of membrane IEA --
GO:0031090 organelle membrane IEA --
genes like me logo Genes that share ontologies with FMO2: view

Pathways & Interactions for FMO2 Gene

genes like me logo Genes that share pathways with FMO2: view

Pathways by source for FMO2 Gene

Gene Ontology (GO) - Biological Process for FMO2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006082 organic acid metabolic process IDA 11744609
GO:0006739 NADP metabolic process IDA 11744609
GO:0006805 xenobiotic metabolic process TAS --
GO:0009404 toxin metabolic process IDA 11744609
GO:0017144 drug metabolic process IDA 11744609
genes like me logo Genes that share ontologies with FMO2: view

No data available for SIGNOR curated interactions for FMO2 Gene

Drugs & Compounds for FMO2 Gene

(7) Drugs for FMO2 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
FAD Approved Pharma 0
Imipramine Approved Pharma Antagonist 30
Oxygen Approved, Vet_approved Pharma 0
Tamoxifen Approved Pharma Antagonist TGF-β modulatory and PKC inhibitory effects, ER antagonist, Anti-Estrogens 390
Water Approved Pharma 0

(9) Additional Compounds for FMO2 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Dimethylaniline-N-oxide
  • Dimethyl(phenyl)amine oxide
  • Dimethylaniline N-oxide
  • N,N-Dimethylaniline N-oxide
  • Nn-dimethylaniline-N-oxide
874-52-2
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton
N,N-Dimethylaniline
  • Dimethylaminobenzene
  • Dimethylaniline
  • Dimethylphenylamine
  • N,N-(Dimethylamino)benzene
  • N,N-Dimethyl-Benzenamine
121-69-7
NADP
  • Adenine-nicotinamide dinucleotide phosphate
  • b-NADP
  • b-Nicotinamide adenine dinucleotide phosphate
  • b-TPN
  • beta-NADP
53-59-8
nadph
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) Adenosine 5'-ester with 1,4-dihydro-1-b-D-ribofuranosylnicotinamide
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) Adenosine 5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosylnicotinamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) P'-5'-ester with 1,4-dihydro-1-beta-D-ribofuranosyl-3-pyridinecarboxamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) P'-5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosyl-3-pyridinecarboxamide
  • b-NADPH
53-57-6
genes like me logo Genes that share compounds with FMO2: view

Transcripts for FMO2 Gene

Unigene Clusters for FMO2 Gene

Flavin containing monooxygenase 2 (non-functional):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for FMO2 Gene

ExUns: 1a · 1b ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8 ^ 9
SP1: - -
SP2: - -
SP3: - - - - - -
SP4: -
SP5: -

Relevant External Links for FMO2 Gene

GeneLoc Exon Structure for
FMO2
ECgene alternative splicing isoforms for
FMO2

Expression for FMO2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FMO2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for FMO2 Gene

This gene is overexpressed in Artery - Aorta (x7.1) and Lung (x5.5).

NURSA nuclear receptor signaling pathways regulating expression of FMO2 Gene:

FMO2

SOURCE GeneReport for Unigene cluster for FMO2 Gene:

Hs.144912

mRNA Expression by UniProt/SwissProt for FMO2 Gene:

Q99518-FMO2_HUMAN
Tissue specificity: Expressed in lung (at protein level). Expressed predominantly in lung, and at a much lesser extent in kidney. Also expressed in fetal lung, but not in liver, kidney and brain.

Evidence on tissue expression from TISSUES for FMO2 Gene

  • Lung(4.7)
  • Muscle(4.3)
genes like me logo Genes that share expression patterns with FMO2: view

Primer Products

No data available for Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for FMO2 Gene

Orthologs for FMO2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for FMO2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FMO2 34 35
  • 99.36 (n)
dog
(Canis familiaris)
Mammalia FMO2 34 35
  • 88.61 (n)
cow
(Bos Taurus)
Mammalia FMO2 34 35
  • 87.02 (n)
mouse
(Mus musculus)
Mammalia Fmo2 34 16 35
  • 82.94 (n)
rat
(Rattus norvegicus)
Mammalia Fmo2 34
  • 82.52 (n)
oppossum
(Monodelphis domestica)
Mammalia FMO2 35
  • 68 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia FMO2 35
  • 65 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia FMO2 35
  • 56 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia MGC89174 34
  • 63.88 (n)
zebrafish
(Danio rerio)
Actinopterygii fmo5 35
  • 46 (a)
ManyToMany
si:dkey-239i20.2 35
  • 44 (a)
ManyToMany
si:dkey-239i20.4 35
  • 42 (a)
ManyToMany
fruit fly
(Drosophila melanogaster)
Insecta Fmo-1 35
  • 29 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea fmo-11 36
  • 42 (a)
fmo-13 36
  • 42 (a)
fmo-15 36
  • 42 (a)
fmo-12 36
  • 40 (a)
fmo-3 35
  • 39 (a)
ManyToMany
fmo-5 35
  • 39 (a)
ManyToMany
fmo-14 36
  • 36 (a)
fmo-1 35
  • 36 (a)
ManyToMany
fmo-2 35
  • 36 (a)
ManyToMany
C01H6.4 36
  • 33 (a)
fmo-4 35
  • 31 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes FMO1 35
  • 26 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 42 (a)
ManyToMany
-- 35
  • 38 (a)
ManyToMany
-- 35
  • 38 (a)
ManyToMany
Species where no ortholog for FMO2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FMO2 Gene

ENSEMBL:
Gene Tree for FMO2 (if available)
TreeFam:
Gene Tree for FMO2 (if available)

Paralogs for FMO2 Gene

Paralogs for FMO2 Gene

(6) SIMAP similar genes for FMO2 Gene using alignment to 1 proteins:

Pseudogenes.org Pseudogenes for FMO2 Gene

genes like me logo Genes that share paralogs with FMO2: view

Variants for FMO2 Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for FMO2 Gene

FMO2_HUMAN-Q99518
The sequence shown is that of the allele FMO2*2A. There are two alleles; one major, FMO2*2A (truncated form) and one minor, FMO2*1 (full-length form similar to the protein found in other mammals) (PubMed:9804831). A nonsense mutation transforms the Gln-472 of FMO2*1 in a premature stop codon (PubMed:9804831). FMO2*2A occurs in essentially 100% of Caucasians and Asians (PubMed:9804831). FMO2*1 is present at a frequency of approximately 4% to 13% in the sample of population of African descent (PubMed:9804831, PubMed:11042094, PubMed:18794725). FMO2*2A is catalytically inactive (PubMed:9804831).

Sequence variations from dbSNP and Humsavar for FMO2 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000197051 -- 171,201,444(+) CAAGC(-/CTT)CTGTG intron-variant
rs1000255077 -- 171,211,147(+) CCTTT(A/C)TAGCA intron-variant, nc-transcript-variant, utr-variant-3-prime
rs1000297217 -- 171,201,778(+) CTAAC(A/C)ATCAT intron-variant
rs1000497999 -- 171,192,532(+) TGAGG(C/T)GGGTG intron-variant
rs1000614168 -- 171,192,747(+) GGTGA(C/T)AGAGC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for FMO2 Gene

Variant ID Type Subtype PubMed ID
esv1702263 CNV deletion 17803354
esv2090208 CNV deletion 18987734
esv2719450 CNV deletion 23290073
esv2719461 CNV deletion 23290073
esv28731 CNV gain+loss 19812545
esv3302661 CNV tandem duplication 20981092
esv3383592 CNV duplication 20981092
nsv831882 CNV loss 17160897
nsv954755 CNV deletion 24416366

Variation tolerance for FMO2 Gene

Residual Variation Intolerance Score: 98.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 25.28; 99.70% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FMO2 Gene

Human Gene Mutation Database (HGMD)
FMO2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
FMO2

Disorders for FMO2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for FMO2 Gene - From: GeneCards

Disorder Aliases PubMed IDs
trimethylaminuria
  • fish malodor syndrome
- elite association - COSMIC cancer census association via MalaCards
Search FMO2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for FMO2

Genetic Association Database (GAD)
FMO2
Human Genome Epidemiology (HuGE) Navigator
FMO2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FMO2
genes like me logo Genes that share disorders with FMO2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for FMO2 Gene

Publications for FMO2 Gene

  1. The potentially deleterious functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa. (PMID: 18794725) Veeramah K.R. … Phillips I.R. (Pharmacogenet. Genomics 2008) 3 4 22 46 64
  2. Ethnic differences in human flavin-containing monooxygenase 2 (FMO2) polymorphisms: detection of expressed protein in African-Americans. (PMID: 11042094) Whetstine J.R. … Hines R.N. (Toxicol. Appl. Pharmacol. 2000) 3 4 22 46 64
  3. The flavin-containing monooxygenase 2 gene (FMO2) of humans, but not of other primates, encodes a truncated, nonfunctional protein. (PMID: 9804831) Dolphin C.T. … Phillips I.R. (J. Biol. Chem. 1998) 2 3 4 22 64
  4. Haplotype and functional analysis of four flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics. (PMID: 15864117) Krueger S.K. … Williams D.E. (Pharmacogenet. Genomics 2005) 3 22 46 64
  5. Differences in FMO2*1 allelic frequency between Hispanics of Puerto Rican and Mexican descent. (PMID: 15355885) Krueger S.K. … Williams D.E. (Drug Metab. Dispos. 2004) 3 22 46 64

Products for FMO2 Gene

Sources for FMO2 Gene

Content
Loading form....