Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FIGNL1 Gene

Aliases for FIGNL1 Gene

  • Fidgetin Like 1 2 3 5
  • Fidgetin-Like 1 2
  • EC 3.6.4.- 4
  • EC 3.6.4 61

External Ids for FIGNL1 Gene

Previous GeneCards Identifiers for FIGNL1 Gene

  • GC07M049976
  • GC07M050219
  • GC07M050253
  • GC07M050286
  • GC07M050479
  • GC07M050361

Summaries for FIGNL1 Gene

Entrez Gene Summary for FIGNL1 Gene

  • This gene encodes a member of the AAA ATPase family of proteins. The encoded protein is recruited to sites of DNA damage where it plays a role in DNA double-strand break repair via homologous recombination. This protein has also been shown to localize to the centrosome and inhibit ciliogenesis, and may regulate the proliferation and differentiation of osteoblasts. [provided by RefSeq, Oct 2016]

GeneCards Summary for FIGNL1 Gene

FIGNL1 (Fidgetin Like 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and four-way junction helicase activity. An important paralog of this gene is FIGN.

UniProtKB/Swiss-Prot for FIGNL1 Gene

  • Involved in DNA double-strand break (DBS) repair via homologous recombination (HR). Recruited at DSB sites independently of BRCA2, RAD51 and RAD51 paralogs in a H2AX-dependent manner. May regulate osteoblast proliferation and differentiation.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FIGNL1 Gene

Genomics for FIGNL1 Gene

Regulatory Elements for FIGNL1 Gene

Enhancers for FIGNL1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07F050414 1.3 FANTOM5 Ensembl ENCODE 53.9 +125.9 125935 4.0 CTCF PKNOX1 CBX3 MXI1 MAX CEBPG EBF1 RAD21 EED ZNF143 FIGNL1 GC07P050435 GC07P050382
GH07F050404 1.4 Ensembl ENCODE 48.3 +136.1 136068 3.9 CTCF ZIC2 RAD21 POLR2A IKZF1 ZNF341 HNF4G HMBOX1 FIGNL1 RNU6-1091P ZPBP C7orf72 GC07P050382 GC07P050435
GH07F050392 1.7 FANTOM5 Ensembl ENCODE 46.9 +146.9 146874 7.0 CTCF KLF1 MTA2 RNF2 ZMYM3 JUNB BMI1 EBF1 EP300 RELA FIGNL1 ENSG00000228005 C7orf72 ZPBP IKZF1 GC07P050382 GC07P050435
GH07F050408 1.1 FANTOM5 Ensembl ENCODE 46.6 +132.2 132178 3.5 USF1 MAX EBF1 RELA ZNF316 POLR2A ELK1 EED ZNF143 NFE2 FIGNL1 RNU6-1091P ENSG00000228005 ZPBP IKZF1 GC07P050382 GC07P050435
GH07F050425 0.4 ENCODE 36.7 +115.7 115712 1.7 FIGNL1 ZPBP C7orf72 GC07P050435 GC07P050382
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around FIGNL1 on UCSC Golden Path with GeneCards custom track

Genomic Location for FIGNL1 Gene

Chromosome:
7
Start:
50,444,128 bp from pter
End:
50,542,535 bp from pter
Size:
98,408 bases
Orientation:
Minus strand

Genomic View for FIGNL1 Gene

Genes around FIGNL1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FIGNL1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FIGNL1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FIGNL1 Gene

Proteins for FIGNL1 Gene

  • Protein details for FIGNL1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q6PIW4-FIGL1_HUMAN
    Recommended name:
    Fidgetin-like protein 1
    Protein Accession:
    Q6PIW4
    Secondary Accessions:
    • D3DVM6
    • Q86V18
    • Q8ND59
    • Q9H8P1
    • Q9H917

    Protein attributes for FIGNL1 Gene

    Size:
    674 amino acids
    Molecular mass:
    74077 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Hexamer (By similarity). Interacts (via N-terminal one-half region) with RAD51; the interaction is direct. Interacts (via N-terminal one-half region) with SPIDR (via the C-terminal region); the interaction is direct.
    SequenceCaution:
    • Sequence=BAB14567.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for FIGNL1 Gene

    Alternative splice isoforms for FIGNL1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FIGNL1 Gene

Selected DME Specific Peptides for FIGNL1 Gene

Q6PIW4:
  • EHESSRRIKTEFLVQLDG
  • QSGATFFSISASSLTSKWVGEGEKMVRALF
  • VIFIDEIDSLLS
  • RPDIFTGLR

Post-translational modifications for FIGNL1 Gene

  • Ubiquitination at Lys 258
  • Modification sites at PhosphoSitePlus

Domains & Families for FIGNL1 Gene

Gene Families for FIGNL1 Gene

Protein Domains for FIGNL1 Gene

Suggested Antigen Peptide Sequences for FIGNL1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q6PIW4

UniProtKB/Swiss-Prot:

FIGL1_HUMAN :
  • The N-terminus is necessary for its recruitment to DNA damage sites.
  • Belongs to the AAA ATPase family.
Domain:
  • The N-terminus is necessary for its recruitment to DNA damage sites.
Family:
  • Belongs to the AAA ATPase family.
genes like me logo Genes that share domains with FIGNL1: view

Function for FIGNL1 Gene

Molecular function for FIGNL1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
Involved in DNA double-strand break (DBS) repair via homologous recombination (HR). Recruited at DSB sites independently of BRCA2, RAD51 and RAD51 paralogs in a H2AX-dependent manner. May regulate osteoblast proliferation and differentiation.

Enzyme Numbers (IUBMB) for FIGNL1 Gene

Gene Ontology (GO) - Molecular Function for FIGNL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding ISS --
GO:0005515 protein binding IPI 23754376
GO:0005524 ATP binding IEA --
GO:0008568 microtubule-severing ATPase activity IBA --
GO:0016787 hydrolase activity ISS --
genes like me logo Genes that share ontologies with FIGNL1: view

Animal Model Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Phenotypes , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for FIGNL1 Gene

Localization for FIGNL1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FIGNL1 Gene

Nucleus. Note=Together with RAD51 and a subset of H2A histone proteins, redistributed in discrete nuclear DNA damage-induced foci after ionizing radiation (IR) treatment.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for FIGNL1 Gene COMPARTMENTS Subcellular localization image for FIGNL1 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 4
mitochondrion 1

Gene Ontology (GO) - Cellular Components for FIGNL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000228 nuclear chromosome IDA 23754376
GO:0005634 nucleus ISS --
GO:0005737 cytoplasm ISS --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with FIGNL1: view

Pathways & Interactions for FIGNL1 Gene

SuperPathways for FIGNL1 Gene

No Data Available

Gene Ontology (GO) - Biological Process for FIGNL1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001649 osteoblast differentiation ISS --
GO:0010569 regulation of double-strand break repair via homologous recombination IDA 23754376
GO:0031122 cytoplasmic microtubule organization IBA --
GO:0033687 osteoblast proliferation ISS --
GO:0043066 negative regulation of apoptotic process ISS --
genes like me logo Genes that share ontologies with FIGNL1: view

No data available for Pathways by source and SIGNOR curated interactions for FIGNL1 Gene

Drugs & Compounds for FIGNL1 Gene

(4) Drugs for FIGNL1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(1) Additional Compounds for FIGNL1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with FIGNL1: view

Transcripts for FIGNL1 Gene

Unigene Clusters for FIGNL1 Gene

Fidgetin-like 1:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for FIGNL1 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c · 3d · 3e · 3f · 3g ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d · 6e · 6f ^ 7a · 7b · 7c · 7d · 7e · 7f ·
SP1: - - - - -
SP2: - - -
SP3: - - - - - -
SP4: - - - - - - - -
SP5: - - - -
SP6: - -
SP7: - - - - - - - - - -
SP8: - - - - - -
SP9: - - - - - - - - - - -
SP10: - - - - - -
SP11: - - - -
SP12: - -
SP13: - - - - -
SP14: - - -
SP15: - - - - - - - - -
SP16: - - - - - - - - -
SP17: - - - - - - - -
SP18: - - - - - - - - - -
SP19: -

ExUns: 7g · 7h
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:

Relevant External Links for FIGNL1 Gene

GeneLoc Exon Structure for
FIGNL1
ECgene alternative splicing isoforms for
FIGNL1

Expression for FIGNL1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FIGNL1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for FIGNL1 Gene

This gene is overexpressed in Cervix (31.6), Tlymphocyte (12.8), Blymphocyte (11.5), and Monocytes (6.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FIGNL1 Gene



Protein tissue co-expression partners for FIGNL1 Gene

NURSA nuclear receptor signaling pathways regulating expression of FIGNL1 Gene:

FIGNL1

SOURCE GeneReport for Unigene cluster for FIGNL1 Gene:

Hs.137516
genes like me logo Genes that share expression patterns with FIGNL1: view

Primer Products

No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for FIGNL1 Gene

Orthologs for FIGNL1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for FIGNL1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FIGNL1 34 35
  • 99.41 (n)
cow
(Bos Taurus)
Mammalia FIGNL1 34 35
  • 86.35 (n)
dog
(Canis familiaris)
Mammalia FIGNL1 34 35
  • 83.18 (n)
mouse
(Mus musculus)
Mammalia Fignl1 34 16 35
  • 82.91 (n)
rat
(Rattus norvegicus)
Mammalia Fignl1 34
  • 82.66 (n)
oppossum
(Monodelphis domestica)
Mammalia FIGNL1 35
  • 74 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia FIGNL1 35
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves FIGNL1 34 35
  • 71.56 (n)
lizard
(Anolis carolinensis)
Reptilia FIGNL1 35
  • 64 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia fignl1 34
  • 65.78 (n)
zebrafish
(Danio rerio)
Actinopterygii fignl1 34 35
  • 59.4 (n)
wufj99a11 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007769 34
  • 60.73 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG3326 36 34 35
  • 53.63 (n)
BG:DS06874.3 36
  • 39 (a)
CG10793 36
  • 37 (a)
worm
(Caenorhabditis elegans)
Secernentea F32D1.1 36
  • 49 (a)
figl-1 35
  • 40 (a)
OneToMany
K04D7.2a 36
  • 38 (a)
K04D7.2b 36
  • 38 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YTA6 35 37
  • 27 (a)
ManyToMany
SAP1 35
  • 23 (a)
ManyToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AT3G27120 34
  • 54.56 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9574 35
  • 74 (a)
OneToOne
Species where no ortholog for FIGNL1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FIGNL1 Gene

ENSEMBL:
Gene Tree for FIGNL1 (if available)
TreeFam:
Gene Tree for FIGNL1 (if available)

Paralogs for FIGNL1 Gene

Paralogs for FIGNL1 Gene

(7) SIMAP similar genes for FIGNL1 Gene using alignment to 7 proteins:

genes like me logo Genes that share paralogs with FIGNL1: view

Variants for FIGNL1 Gene

Sequence variations from dbSNP and Humsavar for FIGNL1 Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs535171403 Uncertain significance 50,445,765(+) CCCGT(-/TGAGA)TAACA reference, frameshift-variant
rs10230307 -- 50,445,159(+) CAGAA(C/T)TTAGA utr-variant-3-prime
rs10230343 -- 50,445,231(+) CTGTA(A/C)TACAG utr-variant-3-prime
rs10232974 -- 50,442,394(+) AGTTA(A/C)AATTT utr-variant-3-prime
rs10235371 -- 50,446,879(+) TACCA(C/T)TGATG reference, missense

Structural Variations from Database of Genomic Variants (DGV) for FIGNL1 Gene

Variant ID Type Subtype PubMed ID
nsv1016665 CNV gain 25217958

Variation tolerance for FIGNL1 Gene

Residual Variation Intolerance Score: 23.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.52; 64.68% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FIGNL1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FIGNL1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FIGNL1 Gene

Disorders for FIGNL1 Gene

Relevant External Links for FIGNL1

Genetic Association Database (GAD)
FIGNL1
Human Genome Epidemiology (HuGE) Navigator
FIGNL1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FIGNL1

No disorders were found for FIGNL1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FIGNL1 Gene

Publications for FIGNL1 Gene

  1. FIGNL1-containing protein complex is required for efficient homologous recombination repair. (PMID: 23754376) Yuan J. … Chen J. (Proc. Natl. Acad. Sci. U.S.A. 2013) 3 4 64
  2. A common variant in DRD3 receptor is associated with autism spectrum disorder. (PMID: 19058789) de Krom M. … van Ree J.M. (Biol. Psychiatry 2009) 3 46 64
  3. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  4. Human chromosome 7: DNA sequence and biology. (PMID: 12690205) Scherer S.W. … Tsui L.-C. (Science 2003) 3 4 64
  5. The DNA sequence of human chromosome 7. (PMID: 12853948) Hillier L.W. … Wilson R.K. (Nature 2003) 3 4 64

Products for FIGNL1 Gene

Sources for FIGNL1 Gene

Content
Loading form....