Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

FIGNL1 Gene

protein-coding   GIFtS: 51
GCID: GC07M050479

fidgetin-like 1
 Explore 5 diseases affiliated with
FIGNL1 via
MalaCards
our new
 Human Malady Compendium 
Biological research products
for FIGNL1    

Aliases
for FIGNL1 gene

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section
Aliases
Fidgetin-Like 11 2
Fidgetin-Like Protein 12
EC 3.6.4.-3
EC 3.6.48

External Ids:    HGNC: 132861   Entrez Gene: 639792   Ensembl: ENSG000001324367   UniProtKB: Q6PIW43   

Export aliases for FIGNL1 gene to outside databases

Previous GC identifers: GC07M049976 GC07M050219 GC07M050253 GC07M050286 GC07M050361


Summaries
for FIGNL1 gene

(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section
UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4
Function: May regulate osteoblast proliferation and differentiation (By similarity)




Genomic Views
for FIGNL1 gene

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000007.13  NC_018918.1  NT_033968.6  NT_079592.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the FIGNL1 gene promoter:
         GR   AML1a   GR-beta   FOXD1   Lmo2   Nkx2-5   YY1   Egr-4   FOXO4   GR-alpha   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): FIGNL1 promoter sequence
   Search SABiosciences Chromatin IP Primers for FIGNL1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat FIGNL1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7p12.1   Ensembl cytogenetic band:  7p12.1   HGNC cytogenetic band: 7p12.2

FIGNL1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
FIGNL1 gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M050479:  view genomic region     (about GC identifiers)

Start:
 50,511,831 bp from pter      End:
 50,518,088 bp from pter
Size:
 6,258 bases      Orientation:
 minus strand

1 alternative location:
Chr7-,CRA_TCAG 50,517,901-50,524,158     

Proteins
for FIGNL1 gene

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section
UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4 (See protein sequence)
Recommended Name: Fidgetin-like protein 1  
Size: 674 amino acids; 74077 Da
Cofactor: Magnesium (By similarity)
Subunit: Hexamer (By similarity)
Sequence caution: Sequence=BAB14567.1; Type=Erroneous initiation;
1 PDB 3D structure from and Proteopedia for FIGNL1:
3D8B (3D)    
Secondary accessions: D3DVM6 Q86V18 Q8ND59 Q9H8P1 Q9H917
Alternative splicing: 2 isoforms:  Q6PIW4-1   Q6PIW4-2   

Explore the universe of human proteins at neXtProt for FIGNL1: NX_Q6PIW4

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q6PIW4

    • 4 DME Specific Peptides for FIGNL1 (Q6PIW4)
     RPDIFTGLR  VIFIDEIDSLLS  EHESSRRIKTEFLVQLDG  QSGATFFSISASSLTSKWVGEGEKMVRALF 

    FIGNL1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (2 alternative transcripts): 
    NP_001036227.1  NP_071399.2  

    ENSEMBL proteins: 
     ENSP00000349356   ENSP00000378924   ENSP00000399997   ENSP00000410811   ENSP00000409674  
     ENSP00000394070   ENSP00000403012   ENSP00000388471   ENSP00000409281   ENSP00000402957  

    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate: FIGNL1
    OriGene Custom Protein Services for FIGNL1 
    GenScript Custom Purified and Recombinant Proteins Services for FIGNL1
    Novus Biologicals FIGNL1 Protein
    Novus Biologicals FIGNL1 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for FIGNL1

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus ISS--
    GO:0005737cytoplasm ISS--


    FIGNL1 for ontologies           About GeneDecksing



    FIGNL1 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for FIGNL1 
    GenScript Custom Superior Antibodies Services for FIGNL1
    Novus Biologicals FIGNL1 Antibodies
    Search for Antibodies for FIGNL1 at Abcam  
    Uscn Antibodies for FIGNL1
    Search ThermoFisher Antibodies for FIGNL1

    Assay Products for FIGNL1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for FIGNL1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for FIGNL1

    Protein Domains /
    Families
    for FIGNL1 gene

    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    FIGNL1 for domains           About GeneDecksing

    4 InterPro domains/families:
     IPR003959 ATPase_AAA_core
     IPR015415 Vps4_C
     IPR003960 ATPase_AAA_CS
     IPR003593 AAA+_ATPase

    Graphical View of Domain Structure for InterPro Entry Q6PIW4

    ProtoNet protein and cluster: Q6PIW4

    1 Blocks protein family: IPB003960 AAA-protein subdomain

    UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4
    Similarity: Belongs to the AAA ATPase family


    Function
    for FIGNL1 gene

    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section
    Function Summary:

         UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4
    Function: May regulate osteoblast proliferation and differentiation (By similarity)
    Catalytic activity: ATP + H(2)O = ADP + phosphate

    Enzyme Numbers (IUBMB): EC 3.6.42 EC 3.6.4.-1

    miRNA
    Products:            		 OriGene 3'-UTR Clone (see all 2): FIGNL1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat FIGNL1
    2 QIAGEN miScript miRNA Assays for microRNAs that regulate FIGNL1:
    hsa-miR-138-2* hsa-miR-3670
    SwitchGear 3'UTR luciferase reporter plasmid: FIGNL1 3' UTR sequence
    Inhib. RNA
    Products:            		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for FIGNL1 (see all 7)
    OriGene shRNA RFP: FIGNL1
    OriGene siRNA: FIGNL1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1

    Gene Editing
    Products:    		DNA2.0 Custom Protein Engineering Service for FIGNL1

    Clone
    Products:             		Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1 (see all 6)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): FIGNL1 (NM_001042762)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for FIGNL1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1 

    Cell Line
    Products:             		GenScript Custom overexpressing Cell Line Services for FIGNL1
    Search LifeMap BioReagents cell lines for FIGNL1

    In Situ Assay
    Products:       
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000287magnesium ion binding ISS--
    GO:0005524ATP binding IEA--
    GO:0016787hydrolase activity ISS--
    GO:0017111nucleoside-triphosphatase activity IEA--


    FIGNL1 for ontologies           About GeneDecksing



    Pathways & Interactions
    for FIGNL1 gene

    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section



    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for FIGNL1

    STRING Interaction Network Preview (showing 1 interactants - click image to see more details)

    5 Interacting proteins for FIGNL1 (Q6PIW42, 3 ENSP000003493564) via UniProtKB, MINT, STRING, and/or I2D
    InteractantInteraction Details
    GeneCardExternal ID(s)
    MAPK1P284823I2D: score=5 
    SUMO1P631653I2D: score=5 
    RAD1O606713I2D: score=1 
    SUMO2ENSP000004059654STRING: ENSP00000405965
    --Q9WMX22MINT-7049114
    About this table

    Gene Ontology (GO): 5 biological process terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0001649osteoblast differentiation ISS--
    GO:0033687osteoblast proliferation ISS--
    GO:0043066negative regulation of apoptotic process ISS--
    GO:0046034ATP metabolic process ISS--
    GO:0051726regulation of cell cycle ISS--


    FIGNL1 for ontologies           About GeneDecksing



    Drugs & Compounds
    for FIGNL1 gene

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for FIGNL1

    1 HMDB Compound for FIGNL1    About this table
    CompoundSynonyms CAS #PubMed Ids
    MagnesiumMagnesium (see all 2)7439-95-4--
    Search CenterWatch for drugs/clinical trials and news about FIGNL1 / FIGL1 

    Transcripts
    for FIGNL1 gene

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section
    REFSEQ mRNAs for FIGNL1 gene (2 alternative transcripts): 
    NM_001042762.1  NM_022116.3  

    Unigene Cluster for FIGNL1:

    Fidgetin-like 1
    Hs.137516  [show with all ESTs]
    Unigene Representative Sequence: AK027537
    10 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000356889(uc003tpb.3) ENST00000395556(uc003tpd.3 uc003tpc.3 uc010kyy.3)
    ENST00000433017(uc003tpe.3) ENST00000419119 ENST00000435566 ENST00000436590
    ENST00000422854 ENST00000440350 ENST00000420829 ENST00000448788

    miRNA
    Products:             		 OriGene 3'-UTR Clone (see all 2): FIGNL1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat FIGNL1
    2 QIAGEN miScript miRNA Assays for microRNAs that regulate FIGNL1:
    hsa-miR-138-2* hsa-miR-3670
    SwitchGear 3'UTR luciferase reporter plasmid: FIGNL1 3' UTR sequence
    Inhib. RNA
    Products:             		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for FIGNL1 (see all 7)
    OriGene shRNA RFP: FIGNL1
    OriGene siRNA: FIGNL1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1
    Clone
    Products:             		 OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1 (see all 6)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): FIGNL1 (NM_001042762)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for FIGNL1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1 
    Primer
    Products:            		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for FIGNL1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1

    Additional cDNA sequence: 

    AK023142.1 AK023411.1 AK027537.1 AK308136.1 AL834387.1 BC051867.1 

    11 DOTS entries:

    DT.40254077  DT.100019488  DT.121043095  DT.101979492  DT.100692796  DT.100752098  DT.121043078  DT.121043075 
    DT.121043094  DT.102823099  DT.100740112 

    24/71 AceView cDNA sequences (see all 71):

    BM724301 AW268660 CA391098 AA218940 AI352323 AW236377 BU741583 BE089376 
    AA308394 BG113016 AI654654 BU171662 BI258933 BE536218 BU570818 BU852610 
    BU657336 CB990516 AW512037 AU131109 BC051867 AL834387 AK023411 BF793442 

    GeneLoc Exon Structure

    5/19 Alternative Splicing Database (ASD) splice patterns (SP) for FIGNL1 (see all 19)    About this scheme

    ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c · 3d · 3e · 3f · 3g ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d · 6e · 6f ^ 7a · 7b · 7c · 7d · 7e · 7f ·
    SP1:                          -                       -     -     -     -                                                                                       
    SP2:                          -                                   -     -                                                                                       
    SP3:                          -                 -     -     -     -     -                                                                                       
    SP4:                          -                       -     -     -     -           -                             -     -                                       
    SP5:                          -                             -     -     -                                                                                       

    ExUns: 7g · 7h
    SP1:            
    SP2:            
    SP3:            
    SP4:            
    SP5:            


    ECgene alternative splicing isoforms for FIGNL1

    Expression
    for FIGNL1 gene

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    FIGNL1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: GATGGATGGA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)
    About this image

    FIGNL1 expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    2 LifeMap In Vivo Development Anatomical Compartments/Cells 
    Tissue Anatomical Compartment CellCategory (developmental path)
    KidneyS-shaped BodyKidney Endothelial CellsEndothelium
    Neural TubeMesencephalic Ventricular ZoneNeural Tube
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization

    See FIGNL1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for FIGNL1

    SOURCE GeneReport for Unigene cluster: Hs.137516
        SABiosciences Custom PCR Arrays for FIGNL1
    Primer
    Products:    		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for FIGNL1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1
    In Situ
    Assay Products:     
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1

    Orthologs
    for FIGNL1 gene

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section
    This gene was present in the common ancestor of eukaryotes.

    Orthologs for FIGNL1 gene from 7/27 species (see all 27)    About this table
    Organism Taxonomic
    classification    		 Gene Description Human
    Similarity    		 Orthology
    Type    		 Details
    chicken
    (Gallus gallus)    		 Aves FIGNL11 fidgetin-like 1 71.3(n)
    72.5(a)    		   420946  XM_001234038.2  XP_001234039.1 
    lizard
    (Anolis carolinensis)    		 Reptilia FIGNL16
    		 --
    		 62(a)
    		 1 ↔ 1
    		 6(50899205-50901271)
    African clawed frog
    (Xenopus laevis)    		 Amphibia 480452522   -- 76.52(n)    48045252 
    zebrafish
    (Danio rerio)    		 Actinopterygii wufj99a112 Transcribed sequence with weak similarity to protein more 75.25(n)    57081422 
    fruit fly
    (Drosophila melanogaster)    		 Insecta CG33261 , 3 adenosinetriphosphatase3
    CG33261    		 46(a)
    (best of 3)3
    53.63(n)1
    49.44(a)1    		   23E33
    335441  NM_134919.31  NP_608763.21 
    worm
    (Caenorhabditis elegans)    		 Secernentea F32D1.13 ATPase 49(a)
    (best of 3)    		   V(4341441-4345810)   --
    thale cress
    (Arabidopsis thaliana)    		 eudicotyledons AT3G271201 P-loop containing nucleoside triphosphate hydrolase-like more 54.56(n)
    51.72(a)    		   822331  NM_113626.3  NP_189348.3 


    ENSEMBL Gene Tree for FIGNL1 (if available)
    TreeFam Gene Tree for FIGNL1 (if available) 

    Paralogs
    for FIGNL1 gene

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for FIGNL1 gene
    SPAST2  IQCA12  FIGN2  
    7 SIMAP similar genes for FIGNL1 using alignment to 7 protein entries:     FIGL1_HUMAN (see all proteins):
    SPAST    VPS4A    VPS4B    KATNA1    PSMC6    KATNAL1
    FIGN

    FIGNL1 for paralogs           About GeneDecksing



    Genomic Variants
    for FIGNL1 gene

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/216 NCBI SNPs in FIGNL1 are shown (see all 216)     About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance    		Chr 7 posSequence#AA
    Chg    		TypeMore#Allele
    freq    		PopTotal
    sample    		More
    ----------
    rs1447443471,2
    		--50511390(+) ACAGCA/GAGACT 2 -- ds50010--------
    rs1146376161,2
    		F,--50511553(+) TAAATT/CCAACA 2 -- ds50011Minor allele frequency- C:0.09WA 118
    rs1176452491,2
    		F,--50511580(+) TTTGTC/TATTTC 2 -- ds50011Minor allele frequency- T:0.07EA 120
    rs1485250561,2
    		--50511636(+) CTCCAC/TGAGAC 2 -- ds50010--------
    rs2020702411,2
    		--50511643(+) AGACC-/AAGGAT 2 -- ds50010--------
    rs788988561,2
    		F,--50511677(+) GTTCAC/GTACCT 2 -- ds50011Minor allele frequency- G:0.11WA 118
    rs1857486011,2
    		--50511830(+) AAAAGC/TTTTAA 2 -- ds50010--------
    rs576512031,2
    		C,F,--50511916(+) ACATAG/TTTCCT 2 -- ut311Minor allele frequency- T:0.03EA 120
    rs1112629011,2
    		--50511939(+) AAAGAC/TAAACA 2 -- ut311Minor allele frequency- T:0.50CSA 2
    rs171520121,2
    		C,F,--50511952(+) CTAGCG/ATCCTG 2 -- ut314Minor allele frequency- A:0.07NA WA 260

    HapMap Linkage Disequilibrium report for FIGNL1 (50511831 - 50518088 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for FIGNL1: --

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing FIGNL1
    DNA2.0 Custom Variant and Variant Library Synthesis for FIGNL1

    Disorders / Diseases
    for FIGNL1 gene

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    FIGNL1 for disorders           About GeneDecksing

    5 diseases for FIGNL1:    About MalaCards
    autism spectrum disorder    spastic paraplegia    paraplegia    spasticity
    microphthalmia

    Human Genome Epidemiology (HuGE) Navigator: FIGNL1 (1 document)

    Export disorders for FIGNL1 gene to outside databases

    Publications
    for FIGNL1 gene

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for FIGNL1 gene, integrated from 9 sources (see all 15):
    (articles sorted by number of sources associating them with FIGNL1)    		    Utopia: connect your pdf to the dynamic
    world of online information

    1. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    2. Human chromosome 7: DNA sequence and biology. (PubMed id 12690205)1, 2 Scherer S.W.... Tsui L.-C. (2003)
    3. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (2003)
    4. A census of human soluble protein complexes. (PubMed id 22939629)1 Havugimana P.C....Emili A. (2012)
    5. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (2011)
    6. A proteome-wide, quantitative survey of in vivo ubiqui tylation sites reveals widespread regulatory roles. (PubMed id 21890473)1 Wagner S.A....Choudhary C. (2011)
    7. Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. (PubMed id 20068231)2 Olsen J.V....Mann M. (2010)
    8. Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci. (PubMed id 21102463)1 Franke A....Parkes M. (2010)
    9. System-wide changes to SUMO modifications in response to heat shock. (PubMed id 19471022)1 Golebiowski F....Hay R.T. (2009)
    10. Lysine acetylation targets protein complexes and co-regulates major cellular functions. (PubMed id 19608861)2 Choudhary C.... Mann M. (2009)

    External Searches for FIGNL1 gene

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  
      Query String
    		PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    Genome Databases showing FIGNL1 gene

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 63979 HGNC: 13286 AceView: FIGNL1 Ensembl:ENSG00000132436 euGenes: HUgn63979
    ECgene: FIGNL1 H-InvDB: FIGNL1

    Other Databases showing FIGNL1 gene

    (According to HUGE)
    About This Section
    		   --

    Specialized Databases showing FIGNL1 gene

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for FIGNL1 Pharmacogenomics, SNPs, Pathways

    Intellectual Property
    for FIGNL1 gene

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    		Patent Information for FIGNL1 gene:
    Search GeneIP for patents involving FIGNL1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    Products
    for FIGNL1 gene

    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     Browse OriGene Antibodies   OriGene shRNA RFP for FIGNL1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for FIGNL1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for FIGNL1  
     OriGene Protein Over-expression Lysate for FIGNL1   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for FIGNL1   OriGene 3'-UTR Clone for FIGNL1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for FIGNL1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for FIGNL1   OriGene Custom Protein Services for FIGNL1  
     OriGene Custom Immunoassay Development  

         		 
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat FIGNL1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing FIGNL1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat FIGNL1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
     GenScript Custom Purified and Recombinant Proteins Services for FIGNL1 GenScript cDNA clones with any tag delivered in your preferred vector for FIGNL1
     GenScript Custom Assay Services for FIGNL1 GenScript Custom Superior Antibodies Services for FIGNL1
     GenScript Custom overexpressing Cell Line Services for FIGNL1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in FIGNL1 promoter
     Search Chromatin IP Primers for FIGNL1
     RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
     Search GNC Networks for FIGNL1
     SABiosciences Custom PCR Arrays for FIGNL1
     Search Tocris compounds for FIGNL1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     FIGNL1 antibodies
     FIGNL1 proteins
     FIGNL1 lysates
     Search for Antibodies for FIGNL1 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for FIGNL1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     FIGNL1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for FIGNL1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1
     SwitchGear 3'UTR luciferase reporter plasmids for FIGNL1
     SwitchGear Promoter luciferase reporter plasmids for FIGNL1
     Search ThermoFisher Antibodies for FIGNL1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 

    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Copyright © 1996-2013 , Weizmann Institute of Science. All Rights Reserved.
    Hot genes      Disease genes      FIGNL1 gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4