Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

FIGNL1 Gene

protein-coding   GIFtS: 55
GCID: GC07M050479

Fidgetin-Like 1

  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

Aliases
Fidgetin-Like 11 2
Fidgetin-Like Protein 12
EC 3.6.4.-3
EC 3.6.48

External Ids:    HGNC: 132861   Entrez Gene: 639792   Ensembl: ENSG000001324367   OMIM: 6153835   UniProtKB: Q6PIW43   

Export aliases for FIGNL1 gene to outside databases

Previous GC identifers: GC07M049976 GC07M050219 GC07M050253 GC07M050286 GC07M050361


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

GeneCards Summary for FIGNL1 Gene: 
FIGNL1 (fidgetin-like 1) is a protein-coding gene. Diseases associated with FIGNL1 include autism spectrum disorder, and microphthalmia. GO annotations related to this gene include nucleoside-triphosphatase activity and magnesium ion binding. An important paralog of this gene is SPAST.

UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4
Function: May regulate osteoblast proliferation and differentiation (By similarity)




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000007.13  NT_033968.6  NC_018918.2  NT_079592.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the FIGNL1 gene promoter:
         GR   AML1a   GR-beta   FOXD1   Lmo2   Nkx2-5   YY1   Egr-4   FOXO4   GR-alpha   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): FIGNL1 promoter sequence
   Search SABiosciences Chromatin IP Primers for FIGNL1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat FIGNL1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7p12.1   Ensembl cytogenetic band:  7p12.1   HGNC cytogenetic band: 7p12.2

FIGNL1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
FIGNL1 gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M050479:  view genomic region     (about GC identifiers)

Start:
50,511,831 bp from pter      End:
50,518,088 bp from pter
Size:
6,258 bases      Orientation:
minus strand

1 alternative location:
Chr7-,CRA_TCAG 50,517,901-50,524,158     

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4 (See protein sequence)
Recommended Name: Fidgetin-like protein 1  
Size: 674 amino acids; 74077 Da
Cofactor: Magnesium (By similarity)
Subunit: Hexamer (By similarity)
Sequence caution: Sequence=BAB14567.1; Type=Erroneous initiation;
1 PDB 3D structure from and Proteopedia for FIGNL1:
3D8B (3D)    
Secondary accessions: D3DVM6 Q86V18 Q8ND59 Q9H8P1 Q9H917
Alternative splicing: 2 isoforms:  Q6PIW4-1   Q6PIW4-2   

Explore the universe of human proteins at neXtProt for FIGNL1: NX_Q6PIW4

Explore proteomics data for FIGNL1 at MOPED 

Post-translational modifications:

  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_Q6PIW4

  • 4 DME Specific Peptides for FIGNL1 (Q6PIW4)
     RPDIFTGLR  VIFIDEIDSLLS  EHESSRRIKTEFLVQLDG  QSGATFFSISASSLTSKWVGEGEKMVRALF 

    FIGNL1 Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    FIGNL1 Protein Expression
    REFSEQ proteins (2 alternative transcripts): 
    NP_001036227.1  NP_071399.2  

    ENSEMBL proteins: 
     ENSP00000349356   ENSP00000378924   ENSP00000399997   ENSP00000410811   ENSP00000409674  
     ENSP00000394070   ENSP00000403012   ENSP00000388471   ENSP00000409281   ENSP00000402957  

    Human Recombinant Protein Products for FIGNL1: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate for FIGNL1
    OriGene Custom MassSpec 
    OriGene Custom Protein Services for FIGNL1
    GenScript Custom Purified and Recombinant Proteins Services for FIGNL1
    Novus Biologicals FIGNL1 Protein
    Novus Biologicals FIGNL1 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates 
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for FIGNL1 

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000228nuclear chromosome IDA--
    GO:0005634nucleus ISS--
    GO:0005737cytoplasm ISS--

    FIGNL1 for ontologies           About GeneDecksing



    FIGNL1 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for FIGNL1
    GenScript Custom Superior Antibodies Services for FIGNL1
    Novus Biologicals FIGNL1 Antibodies
    Abcam antibodies for FIGNL1
    Cloud-Clone Corp. Antibodies for FIGNL1 
    Search ThermoFisher Antibodies for FIGNL1
    LSBio Antibodies in human, mouse, rat for FIGNL1 

    Assay Products for FIGNL1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for FIGNL1
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for FIGNL1
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for FIGNL1 
    Cloud-Clone Corp. CLIAs for FIGNL1


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    HGNC Gene Families: 
    AATP: ATPases / AAA-type

    5 InterPro protein domains:
     IPR003959 ATPase_AAA_core
     IPR015415 Vps4_C
     IPR003960 ATPase_AAA_CS
     IPR027417 P-loop_NTPase
     IPR003593 AAA+_ATPase

    Graphical View of Domain Structure for InterPro Entry Q6PIW4

    ProtoNet protein and cluster: Q6PIW4

    1 Blocks protein domain: IPB003960 AAA-protein subdomain

    UniProtKB/Swiss-Prot: FIGL1_HUMAN, Q6PIW4
    Similarity: Belongs to the AAA ATPase family


    FIGNL1 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: FIGL1_HUMAN, Q6PIW4
    Function: May regulate osteoblast proliferation and differentiation (By similarity)
    Catalytic activity: ATP + H(2)O = ADP + phosphate

         Enzyme Numbers (IUBMB): EC 3.6.42 EC 3.6.4.-1

         Gene Ontology (GO): 5/7 molecular function terms (GO ID links to tree view) (see all 7):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000166nucleotide binding ----
    GO:0000287magnesium ion binding ISS--
    GO:0005515protein binding IPI--
    GO:0005524ATP binding IEA--
    GO:0009378four-way junction helicase activity ----
         
    FIGNL1 for ontologies           About GeneDecksing


    Animal Models:
       inGenious Targeting Laboratory - Custom generated mouse model solutions for FIGNL1 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for FIGNL1

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for FIGNL1 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for FIGNL1 

    miRNA
    Products:
        
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat FIGNL1
    2 QIAGEN miScript miRNA Assays for microRNAs that regulate FIGNL1:
    hsa-miR-138-2* hsa-miR-3670
    SwitchGear 3'UTR luciferase reporter plasmidFIGNL1 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for FIGNL1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for FIGNL1
    Sirion Biotech Customized adenovirus for overexpression of FIGNL1

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for FIGNL1 (see all 13)
    OriGene ORF clones in mouse, rat for FIGNL1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): FIGNL1 (NM_001042762)
    Sino Biological Human cDNA Clone for FIGNL1
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for FIGNL1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1
    Sirion Biotech Customized lentivirus for stable overexpression of FIGNL1 
                         Customized lentivirus expression plasmids for stable overexpression of FIGNL1 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for FIGNL1
    Search LifeMap BioReagents cell lines for FIGNL1
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section




    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for FIGNL1

    STRING Interaction Network Preview (showing 1 interactants - click image to see more details)

    5 Interacting proteins for FIGNL1 (Q6PIW42, 3 ENSP000003493564) via UniProtKB, MINT, STRING, and/or I2D
    InteractantInteraction Details
    GeneCardExternal ID(s)
    MAPK1P284823I2D: score=5 
    SUMO1P631653I2D: score=5 
    RAD1O606713I2D: score=1 
    SUMO2ENSP000004059654STRING: ENSP00000405965
    --Q9WMX22MINT-7049114
    About this table

    Gene Ontology (GO): 5/9 biological process terms (GO ID links to tree view) (see all 9):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0001649osteoblast differentiation ISS--
    GO:0006281DNA repair ----
    GO:0006310DNA recombination ----
    GO:0010569regulation of double-strand break repair via homologous recombination IDA--
    GO:0033687osteoblast proliferation ISS--

    FIGNL1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for FIGNL1 (FIGL1)

    1 HMDB Compound for FIGNL1    About this table
    CompoundSynonyms CAS #PubMed Ids
    MagnesiumMagnesium (see all 2)7439-95-4--

    Search CenterWatch for drugs/clinical trials and news about FIGNL1 / FIGL1

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for FIGNL1 gene (2 alternative transcripts): 
    NM_001042762.1  NM_022116.3  

    Unigene Cluster for FIGNL1:

    Fidgetin-like 1
    Hs.137516  [show with all ESTs]
    Unigene Representative Sequence: AK027537
    10 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000356889(uc003tpb.3) ENST00000395556(uc003tpd.3 uc003tpc.3 uc010kyy.3)
    ENST00000433017(uc003tpe.3) ENST00000419119 ENST00000435566 ENST00000436590
    ENST00000422854 ENST00000440350 ENST00000420829 ENST00000448788
    miRNA
    Products:
         
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat FIGNL1
    2 QIAGEN miScript miRNA Assays for microRNAs that regulate FIGNL1:
    hsa-miR-138-2* hsa-miR-3670
    SwitchGear 3'UTR luciferase reporter plasmidFIGNL1 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for FIGNL1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1
    Clone
    Products:
         
    OriGene clones in human, mouse for FIGNL1 (see all 13)
    OriGene ORF clones in mouse, rat for FIGNL1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): FIGNL1 (NM_001042762)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for FIGNL1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1
    Sirion Biotech Customized lentivirus for stable overexpression of FIGNL1 
                         Customized lentivirus expression plasmids for stable overexpression of FIGNL1 
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for FIGNL1
    OriGene qSTAR qPCR primer pairs in human, mouse for FIGNL1
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1

    Additional mRNA sequence: 

    AK023142.1 AK023411.1 AK027537.1 AK308136.1 AL834387.1 BC051867.1 

    12 DOTS entries:

    DT.40254077  DT.100019488  DT.121043095  DT.101979492  DT.100692796  DT.100752098  DT.121043078  DT.121043075 
    DT.121043094  DT.102823099  DT.100740112  DT.429811 

    24/71 AceView cDNA sequences (see all 71):

    BM724301 AI352323 BE089376 CA391098 AA218940 AW268660 AW236377 BU741583 
    BQ055854 AU134527 BE621264 AA308394 BI258933 BE220786 AL834387 BE220801 
    BG756851 AW512037 NM_022116 BU171662 AA805691 BU657336 BU570818 AU131109 

    GeneLoc Exon Structure

    5/19 Alternative Splicing Database (ASD) splice patterns (SP) for FIGNL1 (see all 19)    About this scheme

    ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c · 3d · 3e · 3f · 3g ^ 4 ^ 5 ^ 6a · 6b · 6c · 6d · 6e · 6f ^ 7a · 7b · 7c · 7d · 7e · 7f ·
    SP1:                          -                       -     -     -     -                                                                                       
    SP2:                          -                                   -     -                                                                                       
    SP3:                          -                 -     -     -     -     -                                                                                       
    SP4:                          -                       -     -     -     -           -                             -     -                                       
    SP5:                          -                             -     -     -                                                                                       

    ExUns: 7g · 7h
    SP1:            
    SP2:            
    SP3:            
    SP4:            
    SP5:            


    ECgene alternative splicing isoforms for FIGNL1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    FIGNL1 expression in normal human tissues (normalized intensities)      FIGNL1 embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: GATGGATGGA
    FIGNL1 Expression
    About this image


    FIGNL1 expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database 
     5/6 selected tissues (see all 6) fully expand
     
     Kidney (Urinary System)
             Presumptive Podocytes Podocyte Layer
     
     Inner Cell Mass (Early Embryonic Tissues)
             Inner Cell Mass Cells Inner Cell Mass
     
     Gonad (Reproductive System)
             Primordial Germ Cells Primitive Gonad
     
     Neural Tube (Nervous System)
             Mesencephalic Ventricular Zone
     
     Choroid Plexus (Nervous System)
             Choroid Plexus Progenitor Cells Choroid Plexus

    See FIGNL1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for FIGNL1

    SOURCE GeneReport for Unigene cluster: Hs.137516
        SABiosciences Custom PCR Arrays for FIGNL1
    Primer
    Products:
    OriGene qPCR primer pairs and template standards for FIGNL1
    OriGene qSTAR qPCR primer pairs in human, mouse for FIGNL1
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for FIGNL1 gene from 9/19 species (see all 19)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Fignl11 , 5 fidgetin-like 11, 5 82.91(n)1
    77.71(a)1
      11 (7.08 cM)5
    605301  NM_001163359.11  NP_001156831.11 
     117874315 
    chicken
    (Gallus gallus)
    Aves FIGNL11 fidgetin-like 1 71.3(n)
    72.5(a)
      420946  XM_001234038.2  XP_001234039.1 
    lizard
    (Anolis carolinensis)
    Reptilia FIGNL16
    Uncharacterized protein
    64(a)
    1 ↔ 1
    6(50899205-50901271)
    African clawed frog
    (Xenopus laevis)
    Amphibia 480452522   -- 76.52(n)    48045252 
    zebrafish
    (Danio rerio)
    Actinopterygii wufj99a112 Transcribed sequence with weak similarity to protein more 75.25(n)    57081422 
    fruit fly
    (Drosophila melanogaster)
    Insecta CG33261 , 3 adenosinetriphosphatase3
    CG33261
    46(a)
    (best of 3)3
    53.63(n)1
    49.44(a)1
      23E33
    335441  NM_134919.31  NP_608763.21 
    worm
    (Caenorhabditis elegans)
    Secernentea F32D1.13 ATPase 49(a)
    (best of 3)
      V(4341441-4345810)   --
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes YTA6(YPL074W)4 Putative ATPase of the CDC48/PAS1/SEC18 (AAA) family, more   --   16(415763-418027) 856031  NP_015251.1 
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons AT3G271201 P-loop containing nucleoside triphosphate hydrolase-like more 54.56(n)
    51.72(a)
      822331  NM_113626.3  NP_189348.3 


    ENSEMBL Gene Tree for FIGNL1 (if available)
    TreeFam Gene Tree for FIGNL1 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for FIGNL1 gene
    SPAST2  IQCA12  FIGN2  
    7 SIMAP similar genes for FIGNL1 using alignment to 7 protein entries:     FIGL1_HUMAN (see all proteins):
    SPAST    VPS4A    VPS4B    KATNA1    PSMC6    KATNAL1
    FIGN

    FIGNL1 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/266 SNPs in FIGNL1 are shown (see all 266)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 7 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1447443471,2
    --50511390(+) ACAGCA/GAGACT 2 -- ds50010--------
    rs1146376161,2
    F--50511553(+) TAAATT/CCAACA 2 -- ds50011Minor allele frequency- C:0.09WA 118
    rs1176452491,2
    C,F--50511580(+) TTTGTC/TATTTC 2 -- ds50011Minor allele frequency- T:0.07EA 120
    rs1485250561,2
    C--50511636(+) CTCCAC/TGAGAC 2 -- ds50010--------
    rs2020702411,2
    --50511643(+) AGACC-/AAGGAT 2 -- ds50010--------
    rs788988561,2
    F--50511677(+) GTTCAC/GTACCT 2 -- ds50011Minor allele frequency- G:0.11WA 118
    rs1857486011,2
    --50511830(+) AAAAGC/TTTTAA 2 -- ds50010--------
    rs576512031,2
    C,F--50511916(+) ACATAG/TTTCCT 2 -- ut311Minor allele frequency- T:0.03EA 120
    rs1112629011,2
    F--50511939(+) AAAGAC/TAAACA 2 -- ut311Minor allele frequency- T:0.50CSA 2
    rs171520121,2
    C,F--50511952(+) CTAGCG/ATCCTG 2 -- ut314Minor allele frequency- A:0.07NA WA 260

    HapMap Linkage Disequilibrium report for FIGNL1 (50511831 - 50518088 bp)

    Structural Variations
          Database of Genomic Variants (DGV) variations for FIGNL1: --
    SABiosciences Cancer Mutation PCR Assays
    SeqTarget long-range PCR primers for resequencing FIGNL1
    DNA2.0 Custom Variant and Variant Library Synthesis for FIGNL1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    OMIM gene information: 615383    OMIM disorders: --

    5 diseases for FIGNL1:    About MalaCards
    autism spectrum disorder    microphthalmia    paraplegia    spasticity
    crohn's disease


    FIGNL1 for disorders           About GeneDecksing

    Genetic Association Database (GAD): FIGNL1
    Human Genome Epidemiology (HuGE) Navigator: FIGNL1 (1 document)

    Export disorders for FIGNL1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for FIGNL1 gene, integrated from 9 sources (see all 18):
    (articles sorted by number of sources associating them with FIGNL1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. A common variant in DRD3 receptor is associated with autism spectrum disorder. (PubMed id 19058789)1, 4 de Krom M....van Ree J.M. (2009)
    2. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    3. Human chromosome 7: DNA sequence and biology. (PubMed id 12690205)1, 2 Scherer S.W.... Tsui L.-C. (2003)
    4. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (2003)
    5. FIGNL1-containing protein complex is required for effi cient homologous recombination repair. (PubMed id 23754376)1 Yuan J. and Chen J. (2013)
    6. A Y2H-seq approach defines the human protein methyltransferase interactome. (PubMed id 23455924)1 Weimann M.... Stelzl U. (2013)
    7. A census of human soluble protein complexes. (PubMed id 22939629)1 Havugimana P.C....Emili A. (2012)
    8. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (2011)
    9. A proteome-wide, quantitative survey of in vivo ubiqui tylation sites reveals widespread regulatory roles. (PubMed id 21890473)1 Wagner S.A....Choudhary C. (2011)
    10. Global identification of modular cullin-RING ligase su bstrates. (PubMed id 21963094)1 Emanuele M.J....Elledge S.J. (2011)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 63979 HGNC: 13286 AceView: FIGNL1 Ensembl:ENSG00000132436 euGenes: HUgn63979
    ECgene: FIGNL1 H-InvDB: FIGNL1

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for FIGNL1 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for FIGNL1 gene:
    Search GeneIP for patents involving FIGNL1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Browse Recombinant/Natural Proteins  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for FIGNL1  
     OriGene qPCR primer pairs and template standards for FIGNL1   OriGene Protein Over-expression Lysate for FIGNL1  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for FIGNL1  
     OriGene qSTAR qPCR primer pairs in human, mouse for FIGNL1   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for FIGNL1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for FIGNL1   OriGene Custom Protein Services for FIGNL1  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat FIGNL1
     QIAGEN SeqTarget long-range PCR primers for resequencing FIGNL1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat FIGNL1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat FIGNL1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat FIGNL1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat FIGNL1
     GenScript Custom Purified and Recombinant Proteins Services for FIGNL1 GenScript cDNA clones with any tag delivered in your preferred vector for FIGNL1
     GenScript Custom Assay Services for FIGNL1 GenScript Custom Superior Antibodies Services for FIGNL1
     GenScript Custom overexpressing Cell Line Services for FIGNL1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in FIGNL1 promoter
     Search Chromatin IP Primers for FIGNL1
     RT2 qPCR Primer Assay in human, mouse, rat FIGNL1
     Search GNC Networks for FIGNL1
     SABiosciences Custom PCR Arrays for FIGNL1
     Search Tocris compounds for FIGNL1 (FIGL1)
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological Cell Lysates
     cDNA Clones for FIGNL1
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     FIGNL1 antibodies
     FIGNL1 proteins
     FIGNL1 lysates
     Antibodies for FIGNL1
     See all of Abcam's Antibodies, Kits and Proteins for FIGNL1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     Proteins for FIGNL1
     Antibodies for FIGNL1
     ELISAs for FIGNL1
     CLIAs for FIGNL1
     Search LifeMap BioReagents cell lines for FIGNL1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for FIGNL1
     SwitchGear 3'UTR luciferase reporter plasmids for FIGNL1
     SwitchGear Promoter luciferase reporter plasmids for FIGNL1
     Search ThermoFisher Antibodies for FIGNL1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat FIGNL1
     inGenious Targeting Laboratory - Custom generated mouse model solutions for FIGNL1
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for FIGNL1
    Customized:
     lentivirus for stable overexpression of FIGNL1
     lentivirus expression plasmids for stable overexpression of FIGNL1
     adenovirus for overexpression of FIGNL1
     LSBio Antibodies in human, mouse, rat for FIGNL1
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 4 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      FIGNL1 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 106 solr: 1.4