Free for academic non-profit institutions. Other users need a Commercial license

FES Gene(Protein Coding)

FES Proto-Oncogene, Tyrosine Kinase

GCID:
GC15P090883
GIFtS:
69
Genes Participants
UDN Logo

Aliases for FES Gene

Aliases for FES Gene

  • FES Proto-Oncogene, Tyrosine Kinase 2 3 5
  • Feline Sarcoma (Snyder-Theilen) Viral (V-Fes)/Fujinami Avian Sarcoma (PRCII) Viral (V-Fps) Oncogene Homolog 2 3
  • Feline Sarcoma/Fujinami Avian Sarcoma Oncogene Homolog 3 4
  • Oncogene FES, Feline Sarcoma Virus 2 3
  • Feline Sarcoma Oncogene 2 3
  • Proto-Oncogene C-Fes 3 4
  • Proto-Oncogene C-Fps 3 4
  • EC 2.7.10.2 4 61
  • P93c-Fes 3 4
  • FPS 3 4
  • Proto-Oncogene Tyrosine-Protein Kinase Fes/Fps 3
  • Tyrosine-Protein Kinase Fes/Fps 3
  • C-Fes/Fps Protein 2
  • EC 2.7.10 61

External Ids for FES Gene

Previous GeneCards Identifiers for FES Gene

  • GC15P087616
  • GC15P084868
  • GC15P089014
  • GC15P089157
  • GC15P089230
  • GC15P091426
  • GC15P067539

Summaries for FES Gene

Entrez Gene Summary for FES Gene

  • This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis as well as growth factor and cytokine receptor signaling. Alternative splicing results in multiple variants encoding different isoforms.[provided by RefSeq, Jan 2009]

GeneCards Summary for FES Gene

FES (FES Proto-Oncogene, Tyrosine Kinase) is a Protein Coding gene. Diseases associated with FES include Sarcoma and Leukemia, Acute Promyelocytic, Somatic. Among its related pathways are Immune response IL-23 signaling pathway and IL-2 Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is FER.

UniProtKB/Swiss-Prot for FES Gene

  • Tyrosine-protein kinase that acts downstream of cell surface receptors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, cell attachment and cell spreading. Plays a role in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Acts down-stream of the activated FCER1 receptor and the mast/stem cell growth factor receptor KIT. Plays a role in the regulation of mast cell degranulation. Plays a role in the regulation of cell differentiation and promotes neurite outgrowth in response to NGF signaling. Plays a role in cell scattering and cell migration in response to HGF-induced activation of EZR. Phosphorylates BCR and down-regulates BCR kinase activity. Phosphorylates HCLS1/HS1, PECAM1, STAT3 and TRIM28.

Gene Wiki entry for FES Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FES Gene

Genomics for FES Gene

Products:

  1. Regulatory Element

Regulatory Elements for FES Gene

Enhancers for FES Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G090867 1.8 FANTOM5 ENCODE dbSUPER 29.5 -12.3 -12335 7.0 MLX ZFP64 FEZF1 DMAP1 YY1 ZNF263 SP3 NFYC SSRP1 GLIS1 FES NIFKP5 ENSG00000270322 ENSG00000259212 FURIN IQGAP1 UNC45A GC15P090874
GH15G090862 1.6 FANTOM5 Ensembl ENCODE dbSUPER 28.8 -19.8 -19798 1.8 PKNOX1 RAD21 YY1 ZSCAN5C FOS CEBPB NR2F2 ZNF341 GLIS1 NR2C1 FES IQGAP1 GC15P090862 GC15P090869
GH15G090835 1.9 FANTOM5 Ensembl ENCODE dbSUPER 20.5 -44.4 -44372 6.8 HDGF FOXA2 ARNT YY1 ZNF766 CBX5 FOS JUNB REST ZNF592 FES BLM FURIN LOC101926911 LOC100631255 UNC45A MAN2A2 HDDC3 ENSG00000200677 ENSG00000259314
GH15G090829 1.6 FANTOM5 Ensembl ENCODE dbSUPER 24.1 -53.1 -53119 2.6 BCOR HDGF ZMYM3 RELA ZNF316 EED RELB NFE2 IKZF2 MTA2 FES UNC45A FURIN LOC101926911 HDDC3 ENSG00000200677 IQGAP1 LOC105370969 GC15M090794
GH15G090860 1 ENCODE dbSUPER 31.4 -23.0 -22956 0.7 SOX13 ESRRA FOXA2 ZNF792 MAX DMAP1 ZNF644 RARA ZNF121 GATA3 FES ENSG00000200677 MAN2A2 GC15P090862 RN7SL363P
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FES on UCSC Golden Path with GeneCards custom track

Promoters for FES Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000081138 805 1001 RING1 CTCF SAP130 AGO1 MAX RBBP5 POLR2A IKZF1 FOXP2 RBFOX2

Transcription factor binding sites by QIAGEN in the FES gene promoter:

Genomic Location for FES Gene

Chromosome:
15
Start:
90,883,695 bp from pter
End:
90,895,776 bp from pter
Size:
12,082 bases
Orientation:
Plus strand

Genomic View for FES Gene

Genes around FES on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FES Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FES Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for FES Gene

Proteins for FES Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for FES Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P07332-FES_HUMAN
    Recommended name:
    Tyrosine-protein kinase Fes/Fps
    Protein Accession:
    P07332
    Secondary Accessions:
    • B2R6E6
    • B4DUD0
    • E9PC94
    • E9PC95
    • Q2VXS7
    • Q2VXS8
    • Q2VXT0
    • Q6GTU5

    Protein attributes for FES Gene

    Size:
    822 amino acids
    Molecular mass:
    93497 Da
    Quaternary structure:
    • Homooligomer. Interacts with BCR. Interacts (when activated, via coiled coil domain) with TRIM28. Interacts (via SH2 domain) with phosphorylated EZR, MS4A2/FCER1B and HCLS1/HS1. Interacts with phosphorylated KIT. Interacts with FLT3. Interacts (via F-BAR domain) with soluble tubulin. Interacts (via SH2 domain) with microtubules.
    Miscellaneous:
    • Cellular homolog of retroviral oncogenes. In contrast to the viral oncoproteins, the kinase activity of cellular FSP/FES is tightly regulated, and the kinase is inactive in normal cells in the absence of activating stimuli (PubMed:15485904).

    Three dimensional structures from OCA and Proteopedia for FES Gene

    Alternative splice isoforms for FES Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for FES Gene

Protein Expression for FES Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for FES Gene

P07332:
  • KAKFLQEA
  • TKKSGVVL
  • RDLAARN
  • NQQTREFVEKG
  • KWTAPEA
  • WYHGAIPR
  • IGRGNFGEVFSGRLRADNT
  • GGDFLTFLR
  • CIHRDLAARNCLV
  • HPNIVRLIGVCTQKQPIYIVMELVQGGDFL
  • LKISDFGMSR
  • RKYQEASKDK
  • KWVLNHED
  • FSLGASPYP
  • QQPLTKKSG
  • LLQDDRHSTSS
  • SQSWAEITSQTE
  • VAVKSCRETLPP
  • YSSESDVWSFGILLWE
  • HAEDLNSGPL
  • RLPCPELCPDAVFRLMEQCWAYEPGQRPSFS
  • EQEREGGRTPTLEILKSH

Post-translational modifications for FES Gene

  • Autophosphorylated on Tyr-713. Phosphorylated by LYN in response to FCER1 activation. Phosphorylated by HCK.
  • Ubiquitination at isoforms=2, 3, 4725
  • Modification sites at PhosphoSitePlus

Other Protein References for FES Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for FES (Fes)

Domains & Families for FES Gene

Gene Families for FES Gene

HGNC:
IUPHAR :

Protein Domains for FES Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for FES Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P07332

UniProtKB/Swiss-Prot:

FES_HUMAN :
  • The coiled coil domains are important for regulating the kinase activity. They mediate homooligomerization and probably also interaction with other proteins.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
Domain:
  • The coiled coil domains are important for regulating the kinase activity. They mediate homooligomerization and probably also interaction with other proteins.
  • The N-terminal region including the first coiled coil domain mediates interaction with phosphoinositide-containing membranes.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
genes like me logo Genes that share domains with FES: view

Function for FES Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for FES Gene

GENATLAS Biochemistry:
feline sarcoma viral (v-fes) oncogene;Fujinami avian sarcoma viral (v-fps) oncogene homolog
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Kinase activity is tightly regulated. Activated in response to signaling from a cell surface receptor. Activation probably requires binding of a substrate via the SH2 domain, plus autophosphorylation at Tyr-713. Present in an inactive form in the absence of activating stimuli.
UniProtKB/Swiss-Prot Function:
Tyrosine-protein kinase that acts downstream of cell surface receptors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, cell attachment and cell spreading. Plays a role in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Acts down-stream of the activated FCER1 receptor and the mast/stem cell growth factor receptor KIT. Plays a role in the regulation of mast cell degranulation. Plays a role in the regulation of cell differentiation and promotes neurite outgrowth in response to NGF signaling. Plays a role in cell scattering and cell migration in response to HGF-induced activation of EZR. Phosphorylates BCR and down-regulates BCR kinase activity. Phosphorylates HCLS1/HS1, PECAM1, STAT3 and TRIM28.

Enzyme Numbers (IUBMB) for FES Gene

Gene Ontology (GO) - Molecular Function for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity TAS --
GO:0004715 non-membrane spanning protein tyrosine kinase activity IDA,IEA 15485904
GO:0005515 protein binding IPI 18046454
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with FES: view
genes like me logo Genes that share phenotypes with FES: view

Animal Models for FES Gene

MGI Knock Outs for FES:

miRNA for FES Gene

miRTarBase miRNAs that target FES

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for FES Gene

Localization for FES Gene

Subcellular locations from UniProtKB/Swiss-Prot for FES Gene

Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle. Golgi apparatus. Cell junction, focal adhesion. Note=Distributed throughout the cytosol when the kinase is not activated. Association with microtubules requires activation of the kinase activity. Shuttles between focal adhesions and cell-cell contacts in epithelial cells. Recruited to the lateral cell membrane in polarized epithelial cells by interaction with phosphorylated EZR. Detected at tubular membrane structures in the cytoplasm and at the cell periphery.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FES gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
cytosol 5
golgi apparatus 5
nucleus 3
mitochondrion 2

Gene Ontology (GO) - Cellular Components for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 11339827
GO:0005794 Golgi apparatus IEA --
GO:0005829 cytosol TAS --
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with FES: view

Pathways & Interactions for FES Gene

genes like me logo Genes that share pathways with FES: view

SIGNOR curated interactions for FES Gene

Activates:
Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for FES Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001578 microtubule bundle formation IEA --
GO:0006468 protein phosphorylation TAS 6183005
GO:0006935 chemotaxis IBA --
GO:0007098 centrosome cycle IEA --
GO:0007173 epidermal growth factor receptor signaling pathway IBA --
genes like me logo Genes that share ontologies with FES: view

Drugs & Compounds for FES Gene

Products:

  1. Drug

(14) Drugs for FES Gene - From: ClinicalTrials, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Fulvestrant Approved, Investigational Pharma Antagonist Estrogen receptor antagonist,high affinity, Hormone therapy 202
Menthol Approved Pharma Partial agonist, Activator 2606
Adenosine triphosphate Approved Nutra 0
Antineoplastic Agents, Hormonal Pharma 5592
Estrogen Antagonists Pharma 1349

(6) Additional Compounds for FES Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for FES Gene

Compound Action Cas Number
Dovitinib (TKI-258, CHIR-258) Multitargeted RTK inhibitor 405169-16-6
genes like me logo Genes that share compounds with FES: view

Transcripts for FES Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for FES Gene

(12) REFSEQ mRNAs :
(11) Additional mRNA sequences :
(85) Selected AceView cDNA sequences:
(17) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for FES Gene

Feline sarcoma oncogene:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for FES Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4a · 4b · 4c ^ 5a · 5b · 5c · 5d ^ 6a · 6b ^ 7a · 7b ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10a · 10b ^
SP1: - - -
SP2:
SP3: - - - - - - -
SP4: - - -
SP5: - - - - - - - - - - - - - - -
SP6:
SP7:
SP8: - - - - - - - - - - - - - - -
SP9: - - - - - - -
SP10: - - - - - - - - -
SP11: - - -
SP12: - -
SP13: -
SP14:
SP15: -
SP16: - -
SP17:

ExUns: 11a · 11b ^ 12a · 12b · 12c · 12d ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b
SP1: - - -
SP2: - - - -
SP3:
SP4:
SP5: - -
SP6: -
SP7: - - - -
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for FES Gene

GeneLoc Exon Structure for
FES
ECgene alternative splicing isoforms for
FES

Expression for FES Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FES Gene

mRNA expression in normal human tissues for FES Gene
mRNA expression by BioGPS for FES GenemRNA expression by GTEx for FES Gene

mRNA differential expression in normal tissues according to GTEx for FES Gene

This gene is overexpressed in Whole Blood (x14.3) and Spleen (x6.8).

Protein differential expression in normal tissues from HIPED for FES Gene

This gene is overexpressed in Spleen (23.7), Peripheral blood mononuclear cells (16.6), Salivary gland (7.2), and Plasma (7.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for FES Gene



Protein tissue co-expression partners for FES Gene

NURSA nuclear receptor signaling pathways regulating expression of FES Gene:

FES

SOURCE GeneReport for Unigene cluster for FES Gene:

Hs.7636

mRNA Expression by UniProt/SwissProt for FES Gene:

P07332-FES_HUMAN
Tissue specificity: Widely expressed. Detected in adult colon epithelium.

Evidence on tissue expression from TISSUES for FES Gene

  • Nervous system(4.4)
  • Liver(4.3)
  • Bone marrow(2.5)
  • Blood(2.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with FES: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for FES Gene

Orthologs for FES Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for FES Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia FES 34 35
  • 99.47 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia FES 35
  • 93 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia FES 34 35
  • 90.61 (n)
cow
(Bos Taurus)
 Mammalia FES 34 35
  • 90.23 (n)
mouse
(Mus musculus)
 Mammalia Fes 34 16 35
  • 87.1 (n)
rat
(Rattus norvegicus)
 Mammalia Fes 34
  • 87.06 (n)
oppossum
(Monodelphis domestica)
 Mammalia FES 35
  • 87 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves FES 34 35
  • 74.11 (n)
lizard
(Anolis carolinensis)
 Reptilia FES 35
  • 56 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia LOC100489191 34
  • 63.98 (n)
zebrafish
(Danio rerio)
 Actinopterygii fes 34 35
  • 61.33 (n)
Dr.13023 34
fruit fly
(Drosophila melanogaster)
 Insecta Fps85D 36 35
  • 36 (a)
worm
(Caenorhabditis elegans)
 Secernentea ZK622.1 36 34
  • 44.63 (n)
T21G5.1 36
  • 38 (a)
W04G5.10 36
  • 37 (a)
F26E4.5 36
  • 36 (a)
frk-1 36
  • 36 (a)
kin-14 36
  • 36 (a)
C25A8.5 36
  • 34 (a)
C35E7.10b 36
  • 34 (a)
C55C3.4 36
  • 34 (a)
F23C8.7 36
  • 34 (a)
W02A2.4 36
  • 34 (a)
ZC581.7 36
  • 34 (a)
C18H7.4 36
  • 33 (a)
C35E7.10a 36
  • 33 (a)
F01D4.3 36
  • 33 (a)
R05H5.4 36
  • 33 (a)
spe-8 36
  • 33 (a)
F57B9.8 36
  • 32 (a)
kin-26 36
  • 32 (a)
Y52D5A.2 36
  • 32 (a)
F46F5.2 36
  • 31 (a)
T25B9.5 36
  • 31 (a)
R11E3.1 36 35
  • 30 (a)
T06C10.3 36
  • 30 (a)
Y69E1A.3 36
  • 30 (a)
K09B11.5 36
  • 29 (a)
T25B9.4 36
  • 29 (a)
Y116A8C.24 36
  • 28 (a)
Y116A8C.38 36
  • 28 (a)
ZK593.9 36
  • 28 (a)
F59A3.8 36
  • 27 (a)
kin-24 36
  • 27 (a)
W03F8.2 36
  • 27 (a)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes CDC15 35
  • 9 (a)
 OneToMany
sea squirt
(Ciona savignyi)
 Ascidiacea -- 35
  • 35 (a)
 OneToMany
Species where no ortholog for FES was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for FES Gene

ENSEMBL:
Gene Tree for FES (if available)
TreeFam:
Gene Tree for FES (if available)

Paralogs for FES Gene

Paralogs for FES Gene

(121) SIMAP similar genes for FES Gene using alignment to 10 proteins:

genes like me logo Genes that share paralogs with FES: view

Variants for FES Gene

Sequence variations from dbSNP and Humsavar for FES Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
rs1000197988 -- 90,893,878(+) TGCCT(C/T)GCCCT intron-variant
rs1000277544 -- 90,884,664(+) AAGGG(C/T)GGGGA intron-variant, upstream-variant-2KB
rs1000401581 -- 90,889,127(+) TATAT(A/C)TATCA intron-variant
rs1000519788 -- 90,889,900(+) CAGGA(A/G)ATGGT nc-transcript-variant, reference, synonymous-codon
rs1000584990 -- 90,884,133(+) ACCCG(C/T)GGACA upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for FES Gene

Variant ID Type Subtype PubMed ID
nsv515661 CNV loss 19592680
nsv833089 CNV loss 17160897
nsv952028 CNV deletion 24416366

Variation tolerance for FES Gene

Residual Variation Intolerance Score: 5.21% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.24; 40.36% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FES Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FES

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FES Gene

Disorders for FES Gene

MalaCards: The human disease database

(5) MalaCards diseases for FES Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
sarcoma
  • connective and soft tissue neoplasm
leukemia, acute promyelocytic, somatic
  • leukemia, acute promyelocytic
bone ewing's sarcoma
  • bone ewing sarcoma
wolfram syndrome 2
  • wfs2
xanthinuria
  • xanthinuria, type i
- elite association - COSMIC cancer census association via MalaCards
Search FES in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

FES_HUMAN
  • Note=Has been shown to act as proto-oncogene in some types of cancer, possibly due to abnormal activation of the kinase. Has been shown to act as tumor suppressor in other types of cancer. Expressed and present as activated kinase in a subset of acute myeloid leukemia patients; promotes survival of leukemia cells (PubMed:20111072). Expression is absent in K562 leukemia cells; ectopic expression of FSP/FES restores myeloid differentiation (PubMed:2656706). May function as tumor suppressor in colorectal cancer; expression is reduced or absent in samples from some colon cancer patients (PubMed:16455651). Ectopic expression of FSP/FES suppresses anchorage-independent growth in colon cancer cell lines (PubMed:16455651). Up-regulated in prostate cancer, and might be a predictor of recurrence after radical surgery (PubMed:21563194). May promote growth of renal carcinoma cells (PubMed:19082481). {ECO:0000269 PubMed:16455651, ECO:0000269 PubMed:19082481, ECO:0000269 PubMed:20111072, ECO:0000269 PubMed:21563194, ECO:0000269 PubMed:2656706}.

Relevant External Links for FES

Genetic Association Database (GAD)
FES
Human Genome Epidemiology (HuGE) Navigator
FES
Tumor Gene Database (TGDB):
FES
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FES
genes like me logo Genes that share disorders with FES: view

No data available for Genatlas for FES Gene

Publications for FES Gene

  1. Contributions of F-BAR and SH2 domains of Fes protein tyrosine kinase for coupling to the FcepsilonRI pathway in mast cells. (PMID: 19001085) McPherson V.A. … Craig A.W. (Mol. Cell. Biol. 2009) 3 4 22 64
  2. Downregulation of the c-Fes protein-tyrosine kinase inhibits the proliferation of human renal carcinoma cells. (PMID: 19082481) Kanda S. … Smithgall T.E. (Int. J. Oncol. 2009) 3 4 22 64
  3. Structural coupling of SH2-kinase domains links Fes and Abl substrate recognition and kinase activation. (PMID: 18775312) Filippakopoulos P. … Knapp S. (Cell 2008) 3 4 22 64
  4. A growth-suppressive function for the c-fes protein-tyrosine kinase in colorectal cancer. (PMID: 16455651) Delfino F.J. … Smithgall T.E. (J. Biol. Chem. 2006) 3 4 22 64
  5. The KRAB-associated co-repressor KAP-1 is a coiled-coil binding partner, substrate and activator of the c-Fes protein tyrosine kinase. (PMID: 16792528) Delfino F.J. … Smithgall T.E. (Biochem. J. 2006) 3 4 22 64

Products for FES Gene

  • Addgene plasmids for FES

Sources for FES Gene

Content
Loading form....