Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FADS3 Gene

Aliases for FADS3 Gene

  • Fatty Acid Desaturase 3 2 3 5
  • Cytochrome B5-Related Protein 3 4
  • Delta-9-Desaturase 2 3
  • CYB5RP 3 4
  • Linoleoyl-CoA Desaturase (Delta-9-Desaturase)-Like 3 3
  • Delta-9 Fatty Acid Desaturase 3
  • EC 1.14.19.- 4
  • EC 1.14.19 56
  • LLCDL3 3

External Ids for FADS3 Gene

Previous HGNC Symbols for FADS3 Gene

  • LLCDL3

Previous GeneCards Identifiers for FADS3 Gene

  • GC11M064126
  • GC11M063216
  • GC11M061416
  • GC11M061324
  • GC11M061397
  • GC11M061640
  • GC11M057969

Summaries for FADS3 Gene

Entrez Gene Summary for FADS3 Gene

  • The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq, Jul 2008]

GeneCards Summary for FADS3 Gene

FADS3 (Fatty Acid Desaturase 3) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water. An important paralog of this gene is FADS2.

Additional gene information for FADS3 Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FADS3 Gene

Genomics for FADS3 Gene

GeneHancer (GH) Regulatory Elements for FADS3 Gene

Promoters and enhancers for FADS3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH11I061885 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE dbSUPER 550.8 +2.8 2808 7.5 SIN3A ZNF2 YY1 ZNF121 GLIS2 ELK1 ATF7 FOS KLF13 DEK FADS3 BEST1 RAB3IL1 FADS2 MIR6746
GH11I061893 Enhancer 1 Ensembl ENCODE dbSUPER 550.8 -1.9 -1924 1.6 ZNF146 MAX MAFG ATF2 ZNF592 ZNF316 MAFF NFE2 ATF7 EMSY FADS3 PIR40157
GH11I061826 Promoter/Enhancer 2.8 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 11.2 +59.7 59682 12.6 HDGF PKNOX1 ARNT ARID4B SIN3A YY1 POLR2B ZNF766 ZNF213 ZNF143 FADS2 MTA2 FADS1 TMEM138 EML3 STX5 CPSF7 NXF1 GANAB TMEM179B
GH11I061916 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE dbSUPER 11.7 -26.5 -26506 4.3 HDGF PKNOX1 CLOCK SMAD1 SIN3A ZBTB7B SP3 REST ZNF592 SMARCA4 RAB3IL1 CSKMT CPSF7 TUT1 TAF6L WDR74 GANAB SNHG1 FADS3 BEST1
GH11I061921 Enhancer 1.5 FANTOM5 Ensembl ENCODE dbSUPER 12 -31.8 -31848 4 ATF1 FOXA2 ARID4B SIN3A ZNF48 ETS1 RXRA SP5 NCOA1 REST RAB3IL1 FADS3 BEST1 FADS1 FTH1 DKFZP434K028 MYRF GC11P061939 PIR40157
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around FADS3 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the FADS3 gene promoter:

Genomic Locations for FADS3 Gene

Genomic Locations for FADS3 Gene
chr11:61,873,519-61,892,051
(GRCh38/hg38)
Size:
18,533 bases
Orientation:
Minus strand
chr11:61,640,991-61,659,523
(GRCh37/hg19)

Genomic View for FADS3 Gene

Genes around FADS3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FADS3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FADS3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FADS3 Gene

Proteins for FADS3 Gene

  • Protein details for FADS3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y5Q0-FADS3_HUMAN
    Recommended name:
    Fatty acid desaturase 3
    Protein Accession:
    Q9Y5Q0
    Secondary Accessions:
    • O60426

    Protein attributes for FADS3 Gene

    Size:
    445 amino acids
    Molecular mass:
    51145 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAC23396.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

neXtProt entry for FADS3 Gene

Selected DME Specific Peptides for FADS3 Gene

Q9Y5Q0:
  • LLIGELAPE
  • TQMNHIP
  • APLVKSLCAKHG
  • DKWLVIER
  • WFSGHLNFQIEHHLFP
  • YFFLIGPPLL
  • FVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPVF
  • LQHDLGH
  • EDATDAF

Post-translational modifications for FADS3 Gene

No Post-translational modifications

Domains & Families for FADS3 Gene

Gene Families for FADS3 Gene

HGNC:
Human Protein Atlas (HPA):
  • Predicted intracellular proteins
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for FADS3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9Y5Q0

UniProtKB/Swiss-Prot:

FADS3_HUMAN :
  • The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Belongs to the fatty acid desaturase type 1 family.
Domain:
  • The histidine box domains may contain the active site and/or be involved in metal ion binding.
Family:
  • Belongs to the fatty acid desaturase type 1 family.
genes like me logo Genes that share domains with FADS3: view

Function for FADS3 Gene

Enzyme Numbers (IUBMB) for FADS3 Gene

Phenotypes From GWAS Catalog for FADS3 Gene

Gene Ontology (GO) - Molecular Function for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003674 molecular_function ND --
GO:0016491 oxidoreductase activity IEA --
genes like me logo Genes that share ontologies with FADS3: view
genes like me logo Genes that share phenotypes with FADS3: view

Animal Model Products

Clone Products

No data available for Molecular function , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for FADS3 Gene

Localization for FADS3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FADS3 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FADS3 gene
Compartment Confidence
plasma membrane 3
endoplasmic reticulum 3
peroxisome 2
nucleus 2
extracellular 1
cytosol 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli fibrillar center (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA,NAS 10860662
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with FADS3: view

Pathways & Interactions for FADS3 Gene

SuperPathways for FADS3 Gene

No Data Available

Interacting Proteins for FADS3 Gene

Gene Ontology (GO) - Biological Process for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IEA --
GO:0006633 fatty acid biosynthetic process IEA --
GO:0006636 unsaturated fatty acid biosynthetic process NAS 10860662
GO:0055114 oxidation-reduction process IEA --
genes like me logo Genes that share ontologies with FADS3: view

No data available for Pathways by source and SIGNOR curated interactions for FADS3 Gene

Drugs & Compounds for FADS3 Gene

(1) Drugs for FADS3 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
heme Pharma Agonist 0
genes like me logo Genes that share compounds with FADS3: view

Transcripts for FADS3 Gene

Unigene Clusters for FADS3 Gene

Fatty acid desaturase 3:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for FADS3 Gene

No ASD Table

Relevant External Links for FADS3 Gene

GeneLoc Exon Structure for
FADS3
ECgene alternative splicing isoforms for
FADS3

Expression for FADS3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for FADS3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for FADS3 Gene

This gene is overexpressed in Placenta (52.1) and Testis (15.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FADS3 Gene



Protein tissue co-expression partners for FADS3 Gene

NURSA nuclear receptor signaling pathways regulating expression of FADS3 Gene:

FADS3

SOURCE GeneReport for Unigene cluster for FADS3 Gene:

Hs.21765

mRNA Expression by UniProt/SwissProt for FADS3 Gene:

Q9Y5Q0-FADS3_HUMAN
Tissue specificity: Has been found in heart, liver, lung, uterus, and brainstem.

Evidence on tissue expression from TISSUES for FADS3 Gene

  • Muscle(4.3)
  • Nervous system(3)
genes like me logo Genes that share expression patterns with FADS3: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for FADS3 Gene

Orthologs for FADS3 Gene

This gene was present in the common ancestor of animals.

Orthologs for FADS3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FADS3 33 34
  • 99.78 (n)
cow
(Bos Taurus)
Mammalia FADS3 33 34
  • 89.09 (n)
dog
(Canis familiaris)
Mammalia FADS3 33 34
  • 88.91 (n)
mouse
(Mus musculus)
Mammalia Fads3 33 16 34
  • 87.94 (n)
rat
(Rattus norvegicus)
Mammalia Fads3 33
  • 87.79 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia FADS3 34
  • 81 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia FADS3 34
  • 72 (a)
OneToOne
chicken
(Gallus gallus)
Aves FADS2 34
  • 61 (a)
OneToMany
lizard
(Anolis carolinensis)
Reptilia -- 34
  • 61 (a)
OneToMany
zebrafish
(Danio rerio)
Actinopterygii fads2 34
  • 54 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea fat-3 34
  • 25 (a)
ManyToMany
fat-4 34
  • 22 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 26 (a)
OneToMany
Species where no ortholog for FADS3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for FADS3 Gene

ENSEMBL:
Gene Tree for FADS3 (if available)
TreeFam:
Gene Tree for FADS3 (if available)

Paralogs for FADS3 Gene

Paralogs for FADS3 Gene

genes like me logo Genes that share paralogs with FADS3: view

Variants for FADS3 Gene

Sequence variations from dbSNP and Humsavar for FADS3 Gene

SNP ID Clin Chr 11 pos Variation AA Info Type
rs1000133069 -- 61,889,410(-) G/A intron_variant
rs1000704007 -- 61,873,501(-) G/A downstream_transcript_variant
rs1000778 -- 61,887,833(-) A/G intron_variant
rs1000871037 -- 61,876,564(-) A/G intron_variant, non_coding_transcript_variant
rs1000895943 -- 61,883,354(-) C/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for FADS3 Gene

Variant ID Type Subtype PubMed ID
dgv217e199 CNV deletion 23128226
esv3626586 CNV loss 21293372
nsv468585 CNV loss 19166990
nsv528697 CNV loss 19592680
nsv555171 CNV loss 21841781

Variation tolerance for FADS3 Gene

Residual Variation Intolerance Score: 21.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.64; 13.77% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for FADS3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FADS3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FADS3 Gene

Disorders for FADS3 Gene

Additional Disease Information for FADS3

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for FADS3 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FADS3 Gene

Publications for FADS3 Gene

  1. Genome-wide association study of plasma polyunsaturated fatty acids in the InCHIANTI Study. (PMID: 19148276) Tanaka T … Ferrucci L (PLoS genetics 2009) 3 22 44 58
  2. cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family. (PMID: 10860662) Marquardt A … Weber BH (Genomics 2000) 3 4 22 58
  3. Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium. (PMID: 21829377) Lemaitre RN … Steffen LM (PLoS genetics 2011) 3 44 58
  4. The fatty acid desaturase 3 gene encodes for different FADS3 protein isoforms in mammalian tissues. (PMID: 19752397) Pédrono F … Legrand P (Journal of lipid research 2010) 3 22 58
  5. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 44 58

Products for FADS3 Gene

Sources for FADS3 Gene

Content
Loading form....