Free for academic non-profit institutions. Other users need a Commercial license

Aliases for FADS3 Gene

Aliases for FADS3 Gene

  • Fatty Acid Desaturase 3 2 3 5
  • Cytochrome B5-Related Protein 3 4
  • Delta-9-Desaturase 2 3
  • CYB5RP 3 4
  • Linoleoyl-CoA Desaturase (Delta-9-Desaturase)-Like 3 3
  • Delta-9 Fatty Acid Desaturase 3
  • EC 1.14.19.- 4
  • EC 1.14.19 61
  • LLCDL3 3

External Ids for FADS3 Gene

Previous HGNC Symbols for FADS3 Gene

  • LLCDL3

Previous GeneCards Identifiers for FADS3 Gene

  • GC11M064126
  • GC11M063216
  • GC11M061416
  • GC11M061324
  • GC11M061397
  • GC11M061640
  • GC11M057969

Summaries for FADS3 Gene

Entrez Gene Summary for FADS3 Gene

  • The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq, Jul 2008]

GeneCards Summary for FADS3 Gene

FADS3 (Fatty Acid Desaturase 3) is a Protein Coding gene. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water. An important paralog of this gene is FADS2.

No data available for UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for FADS3 Gene

Genomics for FADS3 Gene

Regulatory Elements for FADS3 Gene

Enhancers for FADS3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH11F061921 1.5 FANTOM5 Ensembl ENCODE 11.9 -31.6 -31611 4.5 TBP ATF1 CBX3 KLF17 ARID4B ZNF48 RARA ETV6 CREM EGR2 RAB3IL1 FADS3 BEST1 FADS1 MIR1908 FTH1 DKFZP434K028 MYRF GC11P061939 PIR40157
GH11F062104 1.5 FANTOM5 Ensembl ENCODE 11.5 -213.4 -213391 2.5 HDAC1 ATF1 TBL1XR1 SIN3A ZBTB40 ELK1 CEBPB NR2F2 POLR2H MEF2D FTH1 INCENP RAB3IL1 FADS3 BEST1 FADS1 MIR1908 MYRF DKFZP434K028 DAGLA
GH11F061826 1.5 FANTOM5 ENCODE 11.2 +59.7 59682 12.6 HDGF PKNOX1 ARNT CREB3L1 WRNIP1 ARID4B SIN3A YY1 ZNF143 FOS FADS2 INTS5 NXF1 UBXN1 METTL12 MTA2 FADS1 TMEM138 EML3 TMEM109
GH11F061916 1.3 Ensembl ENCODE 11.7 -26.5 -26507 4.3 HDGF ATF1 PKNOX1 CREB3L1 SIN3A GATA2 ZNF263 SP3 NCOA1 REST RAB3IL1 FADS3 BEST1 CD5 PIR40157 GC11P061939
GH11F061841 1.1 ENCODE 12.6 +49.7 49744 1.6 PKNOX1 ARNT MLX ARID4B DMAP1 SLC30A9 SP5 NFYC SMARCB1 KAT8 FADS2 INTS5 TMEM109 NXF1 UBXN1 FADS3 METTL12 CD5 EEF1G VPS37C
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around FADS3 on UCSC Golden Path with GeneCards custom track

Promoters for FADS3 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000563199 551 1801 ATF1 PKNOX1 SIN3A ZNF2 ZNF121 GLIS2 FOS KLF13 SP3 SP5
ENSR00001769023 1851 401 SOX5 CTCF SOX13 RFX1 NFIA FOXA3 FEZF1 ZNF644 RAD21 ZFP69B

Genomic Location for FADS3 Gene

Chromosome:
11
Start:
61,873,519 bp from pter
End:
61,892,051 bp from pter
Size:
18,533 bases
Orientation:
Minus strand

Genomic View for FADS3 Gene

Genes around FADS3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
FADS3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for FADS3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for FADS3 Gene

Proteins for FADS3 Gene

  • Protein details for FADS3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y5Q0-FADS3_HUMAN
    Recommended name:
    Fatty acid desaturase 3
    Protein Accession:
    Q9Y5Q0
    Secondary Accessions:
    • O60426

    Protein attributes for FADS3 Gene

    Size:
    445 amino acids
    Molecular mass:
    51145 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAC23396.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

neXtProt entry for FADS3 Gene

Selected DME Specific Peptides for FADS3 Gene

Q9Y5Q0:
  • LLIGELAPE
  • TQMNHIP
  • APLVKSLCAKHG
  • DKWLVIER
  • WFSGHLNFQIEHHLFP
  • YFFLIGPPLL
  • FVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPVF
  • LQHDLGH
  • EDATDAF

Post-translational modifications for FADS3 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for FADS3 Gene

Gene Families for FADS3 Gene

Protein Domains for FADS3 Gene

Suggested Antigen Peptide Sequences for FADS3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9Y5Q0

UniProtKB/Swiss-Prot:

FADS3_HUMAN :
  • The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Belongs to the fatty acid desaturase type 1 family.
Domain:
  • The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Contains 1 cytochrome b5 heme-binding domain.
Family:
  • Belongs to the fatty acid desaturase type 1 family.
genes like me logo Genes that share domains with FADS3: view

Function for FADS3 Gene

Enzyme Numbers (IUBMB) for FADS3 Gene

Gene Ontology (GO) - Molecular Function for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003674 molecular_function ND --
GO:0016491 oxidoreductase activity IEA --
genes like me logo Genes that share ontologies with FADS3: view
genes like me logo Genes that share phenotypes with FADS3: view

Animal Model Products

  • Taconic Biosciences Mouse Models for FADS3

Inhibitory RNA Products

Flow Cytometry Products

No data available for Molecular function , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for FADS3 Gene

Localization for FADS3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for FADS3 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for FADS3 gene
Compartment Confidence
plasma membrane 3
endoplasmic reticulum 3
peroxisome 2
nucleus 2
extracellular 1
cytosol 1

Gene Ontology (GO) - Cellular Components for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA,NAS 10860662
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with FADS3: view

Pathways & Interactions for FADS3 Gene

SuperPathways for FADS3 Gene

No Data Available

Interacting Proteins for FADS3 Gene

STRING Interaction Network Preview (showing 2 interactants - click image to see details)
http://string-db.org/version_10/api/image/networkList?limit=0&targetmode=proteins&caller_identity=gene_cards&network_flavor=evidence&identifiers=9606.ENSP00000278829%0d%0a9606.ENSP00000344818%0d%0a9606.ENSP00000243997%0d%0a
Selected Interacting proteins: ENSP00000278829 Q9Y5Q0-FADS3_HUMAN for FADS3 Gene via STRING IID

Gene Ontology (GO) - Biological Process for FADS3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006631 fatty acid metabolic process IEA --
GO:0006633 fatty acid biosynthetic process IEA --
GO:0006636 unsaturated fatty acid biosynthetic process NAS 10860662
GO:0055114 oxidation-reduction process IEA --
genes like me logo Genes that share ontologies with FADS3: view

No data available for Pathways by source and SIGNOR curated interactions for FADS3 Gene

Drugs & Compounds for FADS3 Gene

(1) Drugs for FADS3 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
heme Pharma Agonist 0
genes like me logo Genes that share compounds with FADS3: view

Transcripts for FADS3 Gene

Unigene Clusters for FADS3 Gene

Fatty acid desaturase 3:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for FADS3 Gene

No ASD Table

Relevant External Links for FADS3 Gene

GeneLoc Exon Structure for
FADS3
ECgene alternative splicing isoforms for
FADS3

Expression for FADS3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for FADS3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for FADS3 Gene

This gene is overexpressed in Placenta (52.1) and Testis (15.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for FADS3 Gene



Protein tissue co-expression partners for FADS3 Gene

NURSA nuclear receptor signaling pathways regulating expression of FADS3 Gene:

FADS3

SOURCE GeneReport for Unigene cluster for FADS3 Gene:

Hs.21765

mRNA Expression by UniProt/SwissProt for FADS3 Gene:

Q9Y5Q0-FADS3_HUMAN
Tissue specificity: Has been found in heart, liver, lung, uterus, and brainstem.
genes like me logo Genes that share expression patterns with FADS3: view

No data available for mRNA differential expression in normal tissues for FADS3 Gene

Orthologs for FADS3 Gene

This gene was present in the common ancestor of animals.

Orthologs for FADS3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia FADS3 34 35
  • 99.78 (n)
cow
(Bos Taurus)
Mammalia FADS3 34 35
  • 89.09 (n)
dog
(Canis familiaris)
Mammalia FADS3 34 35
  • 88.91 (n)
mouse
(Mus musculus)
Mammalia Fads3 34 16 35
  • 87.94 (n)
rat
(Rattus norvegicus)
Mammalia Fads3 34
  • 87.79 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia FADS3 35
  • 81 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia FADS3 35
  • 72 (a)
OneToOne
chicken
(Gallus gallus)
Aves FADS2 35
  • 61 (a)
OneToMany
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 61 (a)
OneToMany
zebrafish
(Danio rerio)
Actinopterygii fads2 35
  • 54 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea fat-3 35
  • 25 (a)
ManyToMany
fat-4 35
  • 22 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 26 (a)
OneToMany
Species where no ortholog for FADS3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for FADS3 Gene

ENSEMBL:
Gene Tree for FADS3 (if available)
TreeFam:
Gene Tree for FADS3 (if available)

Paralogs for FADS3 Gene

Paralogs for FADS3 Gene

genes like me logo Genes that share paralogs with FADS3: view

Variants for FADS3 Gene

Sequence variations from dbSNP and Humsavar for FADS3 Gene

SNP ID Clin Chr 11 pos Sequence Context AA Info Type
rs1000778 -- 61,887,833(+) ccctt(A/G)agaac intron-variant
rs10585384 -- 61,882,127(+) TTTTT(-/TT)GAGAT intron-variant
rs10732883 -- 61,889,873(+) TTTTA(A/G)AAAAA intron-variant
rs10792319 -- 61,889,405(+) ccagc(A/G)ctttg intron-variant
rs111247800 -- 61,889,723(+) GGGAG(G/T)GGTGG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for FADS3 Gene

Variant ID Type Subtype PubMed ID
nsv555171 CNV loss 21841781
nsv528697 CNV loss 19592680
nsv468585 CNV loss 19166990
esv3626586 CNV loss 21293372
dgv217e199 CNV deletion 23128226

Variation tolerance for FADS3 Gene

Residual Variation Intolerance Score: 21.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.64; 13.77% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for FADS3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
FADS3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for FADS3 Gene

Disorders for FADS3 Gene

Relevant External Links for FADS3

Genetic Association Database (GAD)
FADS3
Human Genome Epidemiology (HuGE) Navigator
FADS3
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
FADS3

No disorders were found for FADS3 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for FADS3 Gene

Publications for FADS3 Gene

  1. Genome-wide association study of plasma polyunsaturated fatty acids in the InCHIANTI Study. (PMID: 19148276) Tanaka T. … Ferrucci L. (PLoS Genet. 2009) 3 22 46 64
  2. cDNA cloning, genomic structure, and chromosomal localization of three members of the human fatty acid desaturase family. (PMID: 10860662) Marquardt A. … Weber B.H. (Genomics 2000) 3 4 22 64
  3. Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium. (PMID: 21829377) Lemaitre R.N. … Steffen L.M. (PLoS Genet. 2011) 3 46 64
  4. The fatty acid desaturase 3 gene encodes for different FADS3 protein isoforms in mammalian tissues. (PMID: 19752397) PAcdrono F. … Legrand P. (J. Lipid Res. 2010) 3 22 64
  5. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64

Products for FADS3 Gene

Sources for FADS3 Gene

Content
Loading form....