Free for academic non-profit institutions. Other users need a Commercial license

Aliases for EZH1 Gene

Aliases for EZH1 Gene

  • Enhancer Of Zeste 1 Polycomb Repressive Complex 2 Subunit 2 3 5
  • Enhancer Of Zeste Homolog 1 3 4
  • EC 2.1.1.43 4 58
  • ENX-2 3 4
  • Enhancer Of Zeste (Drosophila) Homolog 1 2
  • Enhancer Of Zeste Homolog 1 (Drosophila) 2
  • Histone-Lysine N-Methyltransferase EZH1 3
  • KIAA0388 4
  • KMT6B 3

External Ids for EZH1 Gene

Previous GeneCards Identifiers for EZH1 Gene

  • GC17M040422
  • GC17M043016
  • GC17M040761
  • GC17M041225
  • GC17M038105
  • GC17M040852
  • GC17M036617

Summaries for EZH1 Gene

Entrez Gene Summary for EZH1 Gene

  • EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity (Shen et al., 2008 [PubMed 19026780]).[supplied by OMIM, Mar 2009]

GeneCards Summary for EZH1 Gene

EZH1 (Enhancer Of Zeste 1 Polycomb Repressive Complex 2 Subunit) is a Protein Coding gene. Among its related pathways are Interactome of polycomb repressive complex 2 (PRC2) and Lysine degradation. GO annotations related to this gene include chromatin binding and histone methyltransferase activity (H3-K27 specific). An important paralog of this gene is EZH2.

UniProtKB/Swiss-Prot for EZH1 Gene

  • Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates Lys-27 of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate Lys-27 of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation.

Tocris Summary for EZH1 Gene

  • Lysine methyltransferases are enyzmes that catalyze the transfer of methyl groups from S-adenosylmethionine (SAM) to the lysine residues on histones, particularly histones H3 and H4. The dysregulation of this methylation is critical in the development of cancer.

Gene Wiki entry for EZH1 Gene

Additional gene information for EZH1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EZH1 Gene

Genomics for EZH1 Gene

Regulatory Elements for EZH1 Gene

Enhancers for EZH1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17H043366 1.7 Ensembl ENCODE dbSUPER 15.2 -623.6 -623637 4 HNRNPUL1 HDGF PKNOX1 FOXA2 ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 DHX8 NBR2 HMGN1P29 ASB16-AS1 LINC00910 TMUB2 UBTF ENSG00000267340 PSME3 NBR1
GH17H042266 2 FANTOM5 Ensembl ENCODE dbSUPER 10.8 +472.6 472639 12 HDGF PKNOX1 FOXA2 MLX ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 CNTNAP1 TUBG2 ENSG00000267002 ENSG00000259623 ENSG00000267340 STAT5B HSD17B1 ENSG00000267765 EZH1 KAT2A
GH17H042308 2 FANTOM5 Ensembl ENCODE dbSUPER 10.1 +429.0 429022 15 MLX ZFP64 DMAP1 YY1 SLC30A9 ZNF143 ZC3H11A MEF2D SSRP1 GLIS1 ENSG00000267340 HMGN1P29 ACLY STAT5A ENSG00000267002 PLEKHH3 STAT5B ATP6V0A1 CAVIN1 HSD17B1
GH17H043018 1.7 FANTOM5 ENCODE dbSUPER 10.1 -275.5 -275455 4 HDGF PKNOX1 ARNT ARID4B SIN3A DMAP1 ZNF2 ZNF766 FOS SP3 NBR2 ENSG00000267002 ENSG00000267340 HSD17B1 KAT2A HMGN2P15 EZH1 VAT1 NAGLU IFI35
GH17H042772 1.2 ENCODE 12.9 -29.3 -29337 3 HDGF PKNOX1 FOXA2 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 HMGN2P15 DHX8 HMGN1P29 ENSG00000267758 CAVIN1 LINC00910 NKIRAS2 CNTNAP1 MEOX1 RAMP2-AS1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around EZH1 on UCSC Golden Path with GeneCards custom track

Promoters for EZH1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000094453 278 1201 HDGF FOXA2 MLX ZFP64 ARID4B SIN3A DMAP1 SLC30A9 ZNF766 ZNF143

Genomic Location for EZH1 Gene

Chromosome:
17
Start:
42,700,275 bp from pter
End:
42,745,078 bp from pter
Size:
44,804 bases
Orientation:
Minus strand

Genomic View for EZH1 Gene

Genes around EZH1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
EZH1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for EZH1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for EZH1 Gene

Proteins for EZH1 Gene

  • Protein details for EZH1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q92800-EZH1_HUMAN
    Recommended name:
    Histone-lysine N-methyltransferase EZH1
    Protein Accession:
    Q92800
    Secondary Accessions:
    • A6NCH6
    • B4DIJ1
    • B4DIZ7
    • B4DSS2
    • B4E3R7
    • O43287
    • Q14459
    • Q53XP3

    Protein attributes for EZH1 Gene

    Size:
    747 amino acids
    Molecular mass:
    85271 Da
    Quaternary structure:
    • Component of the PRC2/EED-EZH1 complex, which includes EED, EZH1, SUZ12, RBBP4 and AEBP2. The PRC2/EED-EZH1 is less abundant than the PRC2/EED-EZH2 complex, has weak methyltransferase activity and compacts chromatin in the absence of the methyltransferase cofactor S-adenosyl-L-methionine (SAM).
    SequenceCaution:
    • Sequence=BAA20842.2; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for EZH1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for EZH1 Gene

Selected DME Specific Peptides for EZH1 Gene

Q92800:
  • DYRYSQADALKYVGIERE
  • SSSEANSRCQTP
  • VKSEYMRLRQLKR
  • CQNRFPGCRCK
  • VSCKNCSIQRG
  • ALNQYSD
  • HCRKIQLKKD
  • NYDGKVHG
  • TFIEELI
  • GDHRIGIFAKRAIQ
  • CFKYDCFLHPFHATPN
  • KKHLLLAPSDVAGWG
  • SFLFNLN
  • QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLL
  • GEELFFDY
  • QNFCEKFC
  • QCNTKQCPCYLAVRECDPDLCLTCGA
  • ISQDEADRRGKVYDKYM
  • PNCYAKV

Post-translational modifications for EZH1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

Domains & Families for EZH1 Gene

Gene Families for EZH1 Gene

Protein Domains for EZH1 Gene

Suggested Antigen Peptide Sequences for EZH1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q92800

UniProtKB/Swiss-Prot:

EZH1_HUMAN :
  • Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.
Family:
  • Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.
genes like me logo Genes that share domains with EZH1: view

Function for EZH1 Gene

Molecular function for EZH1 Gene

GENATLAS Biochemistry:
Drosophila enhancer of zeste homolog 1,polycomb group,PcG
UniProtKB/Swiss-Prot CatalyticActivity:
S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone].
UniProtKB/Swiss-Prot Function:
Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates Lys-27 of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate Lys-27 of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH2-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation.

Enzyme Numbers (IUBMB) for EZH1 Gene

Phenotypes From GWAS Catalog for EZH1 Gene

Gene Ontology (GO) - Molecular Function for EZH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003682 chromatin binding IEA --
GO:0008168 methyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0018024 histone-lysine N-methyltransferase activity IEA --
genes like me logo Genes that share ontologies with EZH1: view
genes like me logo Genes that share phenotypes with EZH1: view

Animal Models for EZH1 Gene

MGI Knock Outs for EZH1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for EZH1
  • Applied Biological Materials Clones for EZH1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EZH1 Gene

Localization for EZH1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for EZH1 Gene

Nucleus. Note=Colocalizes with trimethylated Lys-27 of histone H3.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for EZH1 gene
Compartment Confidence
nucleus 5
cytosol 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for EZH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm IDA --
GO:0035098 ESC/E(Z) complex IDA 20075857
genes like me logo Genes that share ontologies with EZH1: view

Pathways & Interactions for EZH1 Gene

genes like me logo Genes that share pathways with EZH1: view

Pathways by source for EZH1 Gene

1 GeneTex pathway for EZH1 Gene
1 KEGG pathway for EZH1 Gene

Gene Ontology (GO) - Biological Process for EZH1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
GO:0009653 anatomical structure morphogenesis TAS 8921387
GO:0016569 covalent chromatin modification IEA --
GO:0021766 hippocampus development IEA --
genes like me logo Genes that share ontologies with EZH1: view

No data available for SIGNOR curated interactions for EZH1 Gene

Drugs & Compounds for EZH1 Gene

(3) Drugs for EZH1 Gene - From: ApexBio and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
s-adenosylhomocysteine Experimental Pharma 0
UNC 2400 Pharma negative control of UNC1999, Negative control of UNC 1999 (Cat. No. 4904) 0
UNC1999 Pharma EZH2 inhibitor 0

(1) Additional Compounds for EZH1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
s-adenosylmethionine
  • (3S)-5'-[(3-amino-3-carboxypropyl)methylsulfonio]-5'-deoxyadenosine
  • 2-S-Adenosyl-L-methionine
  • 5'-Deoxyadenosine-5'-L-methionine disulfate ditosylate
  • 5'-Deoxyadenosine-5'-L-methionine disulphate ditosylate
  • Active methionine
29908-03-0

(2) ApexBio Compounds for EZH1 Gene

Compound Action Cas Number
UNC 2400 negative control of UNC1999 1433200-49-7
UNC1999 EZH2 inhibitor 1431612-23-5
genes like me logo Genes that share compounds with EZH1: view

Drug Products

Transcripts for EZH1 Gene

Unigene Clusters for EZH1 Gene

Enhancer of zeste homolog 1 (Drosophila):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for EZH1
  • Applied Biological Materials Clones for EZH1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for EZH1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20a · 20b ^ 21a ·
SP1: - - - -
SP2: - - -
SP3: - -
SP4:
SP5:

ExUns: 21b
SP1:
SP2:
SP3:
SP4:
SP5:

Relevant External Links for EZH1 Gene

GeneLoc Exon Structure for
EZH1
ECgene alternative splicing isoforms for
EZH1

Expression for EZH1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for EZH1 Gene

Protein differential expression in normal tissues from HIPED for EZH1 Gene

This gene is overexpressed in Pancreatic juice (41.8), Placenta (7.7), and Lung (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EZH1 Gene



Protein tissue co-expression partners for EZH1 Gene

NURSA nuclear receptor signaling pathways regulating expression of EZH1 Gene:

EZH1

SOURCE GeneReport for Unigene cluster for EZH1 Gene:

Hs.194669

Evidence on tissue expression from TISSUES for EZH1 Gene

  • Nervous system(4.9)
  • Liver(4.2)
genes like me logo Genes that share expression patterns with EZH1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for EZH1 Gene

Orthologs for EZH1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for EZH1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia EZH1 33 34
  • 99.78 (n)
dog
(Canis familiaris)
Mammalia EZH1 33 34
  • 92.59 (n)
cow
(Bos Taurus)
Mammalia EZH1 33 34
  • 92.19 (n)
rat
(Rattus norvegicus)
Mammalia Ezh1 33
  • 91.03 (n)
oppossum
(Monodelphis domestica)
Mammalia EZH1 34
  • 91 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Ezh1 33 16 34
  • 90.81 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia EZH1 34
  • 62 (a)
OneToOne
chicken
(Gallus gallus)
Aves EZH1 33 34
  • 81.59 (n)
lizard
(Anolis carolinensis)
Reptilia EZH1 34
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ezh1 33
  • 73.45 (n)
zebrafish
(Danio rerio)
Actinopterygii ezh1 33 34
  • 68.16 (n)
fruit fly
(Drosophila melanogaster)
Insecta E(z) 35 34
  • 50 (a)
worm
(Caenorhabditis elegans)
Secernentea mes-2 34
  • 24 (a)
OneToMany
soybean
(Glycine max)
eudicotyledons Gma.3851 33
corn
(Zea mays)
Liliopsida Zm.10343 33
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 52 (a)
OneToMany
Species where no ortholog for EZH1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for EZH1 Gene

ENSEMBL:
Gene Tree for EZH1 (if available)
TreeFam:
Gene Tree for EZH1 (if available)

Paralogs for EZH1 Gene

Paralogs for EZH1 Gene

(1) SIMAP similar genes for EZH1 Gene using alignment to 9 proteins:

genes like me logo Genes that share paralogs with EZH1: view

Variants for EZH1 Gene

Sequence variations from dbSNP and Humsavar for EZH1 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1000004745 -- 42,714,622(+) AGGCA(C/T)AAGCA intron-variant
rs1000004780 -- 42,718,139(+) TGAAT(G/T)AGAGA intron-variant
rs1000010689 -- 42,737,625(+) CAAAC(-/AAACT)ATTCT intron-variant
rs1000128806 -- 42,703,017(+) TAACC(A/T)GTAGG intron-variant
rs1000215170 -- 42,717,538(+) CTGCT(C/T)CTTAA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for EZH1 Gene

Variant ID Type Subtype PubMed ID
esv33998 OTHER inversion 15654335
nsv1146669 OTHER inversion 26484159
nsv833450 CNV loss 17160897

Variation tolerance for EZH1 Gene

Residual Variation Intolerance Score: 11.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.68; 14.46% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for EZH1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
EZH1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EZH1 Gene

Disorders for EZH1 Gene

Relevant External Links for EZH1

Genetic Association Database (GAD)
EZH1
Human Genome Epidemiology (HuGE) Navigator
EZH1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
EZH1

No disorders were found for EZH1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for EZH1 Gene

Publications for EZH1 Gene

  1. Characterization of EZH1, a human homolog of Drosophila Enhancer of zeste near BRCA1. (PMID: 8921387) Abel KJ … Weber BL (Genomics 1996) 2 3 4 60
  2. MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer. (PMID: 20819778) Zhang X … Wu X (Carcinogenesis 2010) 3 45 60
  3. Ezh1 and Ezh2 maintain repressive chromatin through different mechanisms. (PMID: 19026781) Margueron R … Reinberg D (Molecular cell 2008) 3 4 60
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 60
  5. Cloning and expression of a human/mouse Polycomb group gene, ENX-2/Enx-2. (PMID: 9473645) Ogawa M … Aiso S (Biochimica et biophysica acta 1998) 3 4 60

Products for EZH1 Gene

  • Addgene plasmids for EZH1

Sources for EZH1 Gene

Content
Loading form....