Aliases for EPHA5 Gene
Aliases for EPHA5 Gene
External Ids for EPHA5 Gene
- HGNC: 3389
- Entrez Gene: 2044
- Ensembl: ENSG00000145242
- OMIM: 600004
- UniProtKB: P54756
Previous GeneCards Identifiers for EPHA5 Gene
- GC04U990011
- GC04M066173
- GC04M066193
- GC04M066014
- GC04M065872
- GC04M062095
Summaries for EPHA5 Gene
-
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]
GeneCards Summary for EPHA5 Gene
EPHA5 (EPH Receptor A5) is a Protein Coding gene. Diseases associated with EPHA5 include Acrodermatitis Chronica Atrophicans and Drug-Induced Mental Disorder. Among its related pathways are GPCR Pathway and EPHA forward signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3.
UniProtKB/Swiss-Prot for EPHA5 Gene
-
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).
-
Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EPHA5 Gene
Genomics for EPHA5 Gene
Regulatory Elements for EPHA5 Gene
Enhancers for EPHA5 Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH04G065667 | 1.4 | FANTOM5 Ensembl ENCODE | 12.8 | +1.1 | 1146 | 3.7 | CBX3 ZNF76 GLIS2 GATA2 ZNF366 FOS EGR2 ZNF263 SP3 KDM1A | EPHA5 GC04M065667 EPHA5-AS1 |
| GH04G066123 | 0.5 | VISTA | 4.3 | -453.7 | -453711 | 0.9 | EPHA5 LOC728048 GC04P066168 | |
| GH04G066095 | 0.2 | Ensembl | 10.4 | -423.9 | -423906 | 0.4 | EPHA5 LOC728048 GC04P066168 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around EPHA5 on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the EPHA5 gene promoter:
Regulatory Element Products
Genomic Location for EPHA5 Gene
- Chromosome:
- 4
- Start:
- 65,319,563 bp from pter
- End:
- 65,670,495 bp from pter
- Size:
- 350,933 bases
- Orientation:
- Minus strand
Genomic View for EPHA5 Gene
Genes around EPHA5 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 4q13.2 by Ensembl
- 4q13.1-q13.2 by Entrez Gene
- 4q13.1-q13.2 by HGNC
EPHA5 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for EPHA5 Gene
Proteins for EPHA5 Gene
-
Protein details for EPHA5 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P54756-EPHA5_HUMAN
- Recommended name:
- Ephrin type-A receptor 5
- Protein Accession:
- P54756
- Q7Z3F2
Protein attributes for EPHA5 Gene
- Size:
- 1037 amino acids
- Molecular mass:
- 114803 Da
- Quaternary structure:
-
- Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).
Protein Expression for EPHA5 Gene
Selected DME Specific Peptides for EPHA5 Gene
- P54756:
-
- MKLNTEVR
- QLVGMLRG
- RDLAARN
- GAGEFGEV
- RWTAPEAI
- DTGGRKD
- RKFTSASD
- LEDDPEAAYTT
- AHTNYTFE
- TTNQAAPS
- SVRVYYKKCP
- GYTEKQRRDFL
- GMKYLSDM
- SDVWSYGI
- MIVTEYMENGSLD
- DTIAADE
- LDKLIRNP
- ALVSVRV
- CTRPPSAP
- KAKQDPEEEKM
- QETSYTI
- EGEWLVPIGKC
- RARTAAGYG
- LEGVVTKS
- QAVHEFAKE
- NLVCKVSDFGLSR
- KFTLRDCNS
- WTCLLLCAALR
- LAFQDVGAC
- GFYLAFQD
- PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI
- YVFQIRA
- DGQFTVIQL
- EEGYRLP
- ISNVNETS
- GRLKLPG
- FSRRFEFET
- EASIMGQF
- NGVSDLS
- EPDRPNG
- FPDTITGADSSQLLEVSG
- QLMLDCW
- TYEDPNQAV
- LMLDCWQK
- DPHTYEDP
- SYGERPYW
- IMGQFDHPNII
- LKLPGKR
- DMGYVHRDLAARNIL
Post-translational modifications for EPHA5 Gene
- Phosphorylated. Phosphorylation is stimulated by the ligand EFNA5. Dephosphorylation upon stimulation by glucose, inhibits EPHA5 forward signaling and results in insulin secretion (By similarity).
- Glycosylation at Asn264, Asn299, isoforms=2, 3369, Asn423, isoforms=2, 3436, and Asn461
- Modification sites at PhosphoSitePlus
Other Protein References for EPHA5 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for EPHA5 (EphA5)
- Cell Signaling Technology (CST) Antibodies for EPHA5 (EphA5)
-
Custom Antibody ServicesOriGene Antibodies for EPHA5
- Novus Biologicals Antibodies for EPHA5
-
Abcam antibodies for EPHA5
- Invitrogen Antibodies for EPHA5
- antibodies-online Antibodies for EPHA5: See all 113
- GeneTex EPHA5 antibody for EPHA5
-
Santa Cruz Biotechnology (SCBT) Antibodies for EPHA5
Protein Products
- R&D Systems Proteins and Enzymes for EPHA5 (EphA5)
-
OriGene Purified Proteins for EPHA5
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA5
- Origene Custom Protein Services for EPHA5
- Novus Biologicals proteins for EPHA5
- antibodies-online Proteins for EPHA5: See all 6
- Search antibodies-online for peptides
- Search GeneTex for Proteins for EPHA5
-
Abcam proteins for EPHA5
Assay Products
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA5 (EphA5)
- antibodies-online Kits for EPHA5: See all 6
Domains & Families for EPHA5 Gene
Gene Families for EPHA5 Gene
Protein Domains for EPHA5 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for EPHA5 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P54756UniProtKB/Swiss-Prot:
EPHA5_HUMAN :- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Function for EPHA5 Gene
Molecular function for EPHA5 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
- UniProtKB/Swiss-Prot Function:
- Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).
Enzyme Numbers (IUBMB) for EPHA5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004713 | protein tyrosine kinase activity | IEA | -- |
| GO:0004714 | transmembrane receptor protein tyrosine kinase activity | IEA | -- |
| GO:0005003 | ephrin receptor activity | IEA,ISS | -- |
| GO:0005004 | GPI-linked ephrin receptor activity | IEA,ISS | -- |
Phenotypes for EPHA5 Gene
- MGI mutant phenotypes for EPHA5:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for EPHA5:
Animal Models for EPHA5 Gene
- MGI Knock Outs for EPHA5:
-
- Epha5 tm1Jgf
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA5
-
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
- Search ViGene Biosciences for EPHA5
CRISPR Products
-
OriGene CRISPR knockouts for EPHA5
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
miRNA for EPHA5 Gene
- miRTarBase miRNAs that target EPHA5
-
- hsa-mir-34a-5p (MIRT006576)
- hsa-mir-181a-5p (MIRT025144)
- hsa-mir-574-5p (MIRT523880)
- hsa-mir-1277-5p (MIRT523881)
- hsa-mir-5010-3p (MIRT523882)
- hsa-mir-147a (MIRT523883)
- hsa-mir-6818-5p (MIRT523884)
- hsa-mir-297 (MIRT523885)
- hsa-mir-190a-3p (MIRT523886)
- hsa-mir-6867-5p (MIRT523887)
- hsa-mir-223-5p (MIRT523888)
- hsa-mir-567 (MIRT523889)
- hsa-mir-511-3p (MIRT523890)
- hsa-mir-5011-5p (MIRT542992)
miRNA Products
- Search ViGene Biosciences for EPHA5
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for EPHA5
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
- ESI BIO PureStem E15, Meso-prx/latp Progenitor for EPHA5
-
Horizon Cell Lines for EPHA5
-
ViGene Biosciences adenoviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EPHA5 Gene
Localization for EPHA5 Gene
Subcellular locations from UniProtKB/Swiss-Prot for EPHA5 Gene
- Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| endoplasmic reticulum | 5 |
| nucleus | 2 |
| mitochondrion | 1 |
| cytosol | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005791 | rough endoplasmic reticulum | IDA | 10375373 |
| GO:0005886 | plasma membrane | TAS | -- |
| GO:0005887 | integral component of plasma membrane | IEA | -- |
| GO:0005912 | adherens junction | IEA | -- |
| GO:0009897 | external side of plasma membrane | IDA | 10064801 |
Pathways & Interactions for EPHA5 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | GPCR Pathway |
.73
.62
|
.55
|
| 2 | EPHA forward signaling | ||
| 3 | ERK Signaling |
.61
.58
|
.49
|
| 4 | Nanog in Mammalian ESC Pluripotency |
.61
|
.48
|
| 5 | Actin Nucleation by ARP-WASP Complex |
.41
|
|
Pathways by source for EPHA5 Gene
1 Cell Signaling Technology pathway for EPHA5 Gene
3 BioSystems pathways for EPHA5 Gene
5 Reactome pathways for EPHA5 Gene
1 KEGG pathway for EPHA5 Gene
3 GeneGo (Thomson Reuters) pathways for EPHA5 Gene
Interacting Proteins for EPHA5 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | IEA | -- |
| GO:0007399 | nervous system development | IEA | -- |
| GO:0007411 | axon guidance | ISS,IEA | -- |
| GO:0016310 | phosphorylation | IEA | -- |
Drugs & Compounds for EPHA5 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for EPHA5 Gene
mRNA/cDNA for EPHA5 Gene
- (12) REFSEQ mRNAs :
- (7) Additional mRNA sequences :
- (27) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for EPHA5
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
miRNA Products
- Search ViGene Biosciences for EPHA5
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for EPHA5
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Expression for EPHA5 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Blood (Hematopoietic System)
- Mesenchymal Stem Cells
- Umbilical Cord (Extraembryonic Tissues)
-
Ovary (Reproductive System)
- Cumulus Cells Antral Follicle
-
Peripheral Nervous System (Nervous System)
- Immature Schwann Cells Peripheral Nerve Domain
-
Limb (Muscoskeletal System)
- Limb Muscle Progenitor Cells Forelimb Myotome
-
Skeletal Muscle (Muscoskeletal System)
- Limb Muscle Progenitor Cells Forelimb Myotome
-
Pancreas (Endocrine System)
- Mature Beta Cells Islets of Langerhans
- Lateral Plate Mesoderm (Gastrulation Derivatives)
- Paraxial Mesoderm (Gastrulation Derivatives)
-
Brain (Nervous System)
mRNA differential expression in normal tissues according to GTEx for EPHA5 Gene
This gene is overexpressed in Brain - Frontal Cortex (BA9) (x7.9), Brain - Hippocampus (x7.5), Brain - Anterior cingulate cortex (BA24) (x7.5), Brain - Amygdala (x5.7), and Brain - Cortex (x4.7).
This gene is overexpressed in Fetal Brain (45.7) and Cerebrospinal fluid (19.6).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EPHA5 Gene
NURSA nuclear receptor signaling pathways regulating expression of EPHA5 Gene:
EPHA5SOURCE GeneReport for Unigene cluster for EPHA5 Gene:
Hs.654492mRNA Expression by UniProt/SwissProt for EPHA5 Gene:
P54756-EPHA5_HUMAN
Tissue specificity:
Almost exclusively expressed in the nervous system in cortical neurons, cerebellar Purkinje cells and pyramidal neurons within the cortex and hippocampus. Display an increasing gradient of expression from the forebrain to hindbrain and spinal cord.
Evidence on tissue expression from TISSUES for EPHA5 Gene
- Nervous system(4.7)
- Eye(4.3)
Primer Products
-
OriGene qPCR primer pairs for EPHA5
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for EPHA5 Gene
Orthologs for EPHA5 Gene
This gene was present in the common ancestor of chordates.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | EPHA5 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | EPHA5 35 |
|
OneToOne | |
| LOC100337226 34 |
|
||||
| dog (Canis familiaris) |
Mammalia | EPHA5 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | EPHA5 35 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | EPHA5 35 |
|
OneToOne | |
| rat (Rattus norvegicus) |
Mammalia | Epha5 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Epha5 34 16 35 |
|
||
| chicken (Gallus gallus) |
Aves | EPHA5 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | EPHA5 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | epha5 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | CT990561.1 35 |
|
OneToOne | |
| LOC797595 34 |
|
- Species where no ortholog for EPHA5 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for EPHA5 Gene
Paralogs for EPHA5 Gene
(47) SIMAP similar genes for EPHA5 Gene using alignment to 5 proteins:
- EPHA3
- EPHA4
- EPHA6
- EPHA7
- EPHB1
- EPHB2
- ABL1
- EPHA8
- EPHB2 variant protein
- EPHA2
- EPHB3
- FGR
- FES
- tec
- EPHA10
- FYN
- SRC
- MET
- HCK
- SRMS
- BTK kinase deficient isoform 6
- EPHA1
- LCK
- EPHB4
- BRAF
- BLK
- YES1
- LYN
- FRK
- EPHB6
- DKFZp434L0319
- CSK
- TXK
- TNK2
- MST1R
- PTK7
- PTK6
- BTK kinase deficient isoform 4
- BTK kinase deficient isoform 2
- ERBB4
- urf-ret
- BTK
- FGFR2
- DKFZp686M05208
- CAMK1
- NUAK1
- FGFR1
Variants for EPHA5 Gene
| SNP ID | Clin | Chr 04 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs199614818 | A lung adenocarcinoma sample | 65,490,529(+) | TTTGC(A/C/T)GGGGA | intron-variant, reference, missense | |
| VAR_042142 | A lung large cell carcinoma sample | ||||
| VAR_042143 | A lung adenocarcinoma sample | ||||
| VAR_042146 | A lung squamous cell carcinoma sample | ||||
| VAR_042148 | A lung large cell carcinoma sample |
Residual Variation Intolerance Score:
6.57% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.77;
66.62% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for EPHA5 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EPHA5 Gene
Disorders for EPHA5 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| acrodermatitis chronica atrophicans |
|
|
| drug-induced mental disorder |
|
|
| drug psychosis |
|
|
| leber congenital amaurosis 17 |
|
|
| lung large cell carcinoma |
|
|
Search EPHA5 in MalaCards
View complete list of genes associated with diseases
Relevant External Links for EPHA5
No data available for UniProtKB/Swiss-Prot and Genatlas for EPHA5 Gene
Publications for EPHA5 Gene
- Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PMID: 9267020) (Cell 1997) 2 3 4 64
- Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure. (PMID: 22174851) Lingappa J.R. … Goldstein D. (PLoS ONE 2011) 3 46 64
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
- Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer. (PMID: 19733895) Fu D.Y. … Shao Z.M. (Hum. Pathol. 2010) 3 22 64
- Immunohistochemical localization of EphA5 in the adult human central nervous system. (PMID: 10375373) Olivieri G. … Miescher G.C. (J. Histochem. Cytochem. 1999) 3 4 64
Products for EPHA5 Gene
- R&D Systems Antibodies for EPHA5 (EphA5)
- R&D Systems Proteins and Enzymes for EPHA5 (EphA5)
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA5 (EphA5)
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for EPHA5
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for EPHA5
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA5
- Origene Custom Protein Services for EPHA5
- Origene RNAi, siRNA, and shRNA products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
- OriGene qPCR primer pairs for EPHA5
- OriGene CRISPR knockouts for EPHA5
- OriGene ORF clones in human for EPHA5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For EPHA5
- GenScript: Next-day shipping cDNA ORF clone for EPHA5 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for EPHA5
- GenScript Custom Assay Services for EPHA5
- GenScript Custom overexpressing Cell Line Services for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for EPHA5
- Cell Signaling Technology (CST) Antibodies for EPHA5 (EphA5)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for EPHA5
- Novus Biologicals proteins for EPHA5
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for EPHA5
- Abcam proteins for EPHA5
- Find your target
- Search knockout validated antibodies
- Browse monoclonal antibodies
- Invitrogen Antibodies for EPHA5
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for EPHA5
- antibodies-online Antibodies for EPHA5: See all 113
- antibodies-online Kits for EPHA5: See all 6
- antibodies-online Proteins for EPHA5: See all 6
- Search antibodies-online for peptides
- GeneTex EPHA5 antibody for EPHA5
- Search GeneTex for Proteins for EPHA5
- ViGene Biosciences adenoviral particle packaged cDNA for EPHA5 gene
- ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
- ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
- Search ViGene Biosciences for EPHA5
- Santa Cruz Biotechnology (SCBT) Antibodies for EPHA5
- Search Santa Cruz Biotechnology (SCBT) for EPHA5 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- Horizon Cell Lines for EPHA5
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA5
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for EPHA5 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer