Free for academic non-profit institutions. Other users need a Commercial license

EPHA5 Gene(Protein Coding)

EPH Receptor A5

GCID:
GC04M065319
GIFtS:
55
Genes Participants
UDN Logo

Aliases for EPHA5 Gene

Aliases for EPHA5 Gene

  • EPH Receptor A5 2 3 5
  • Brain-Specific Kinase 3 4
  • EPH Homology Kinase 1 3 4
  • EPH-Like Kinase 7 3 4
  • EC 2.7.10.1 4 56
  • TYRO4 3 4
  • EHK-1 3 4
  • EHK1 3 4
  • HEK7 3 4
  • EK7 3 4
  • Tyrosine-Protein Kinase Receptor EHK-1 3
  • Receptor Protein-Tyrosine Kinase HEK7 3
  • Ephrin Type-A Receptor 5 3
  • EC 2.7.10 56
  • EphA5 2
  • CEK7 3
  • BSK 4

External Ids for EPHA5 Gene

Previous GeneCards Identifiers for EPHA5 Gene

  • GC04U990011
  • GC04M066173
  • GC04M066193
  • GC04M066014
  • GC04M065872
  • GC04M062095

Summaries for EPHA5 Gene

Entrez Gene Summary for EPHA5 Gene

  • This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

GeneCards Summary for EPHA5 Gene

EPHA5 (EPH Receptor A5) is a Protein Coding gene. Diseases associated with EPHA5 include Leber Congenital Amaurosis 17 and Acrodermatitis Chronica Atrophicans. Among its related pathways are Development Slit-Robo signaling and EPH-Ephrin signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3.

UniProtKB/Swiss-Prot for EPHA5 Gene

  • Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).

Tocris Summary for EPHA5 Gene

  • Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.

Gene Wiki entry for EPHA5 Gene

Additional gene information for EPHA5 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EPHA5 Gene

Genomics for EPHA5 Gene

Products:

  1. Regulatory Element

GeneHancer (GH) Regulatory Elements for EPHA5 Gene

Promoters and enhancers for EPHA5 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH04I065667 Promoter/Enhancer 2.2 EPDnew FANTOM5 Ensembl ENCODE 562.8 +1.1 1146 3.7 CTCF MXI1 USF1 ZBTB6 MAX MZF1 ZNF76 ZIC2 ZNF335 ZFHX2 EPHA5 EPHA5-AS1 GC04M065667
GH04I066095 Enhancer 0.2 Ensembl 10.4 -423.9 -423906 0.4 LOC728048 EPHA5 GC04P066168 ENSG00000249413
GH04I066123 Enhancer 0.4 VISTA 4.3 -453.7 -453710 0.9 EPHA5 LOC728048 GC04P066168 ENSG00000249413
GH04I065573 Promoter 0.5 Ensembl 0.2 +96.9 96894 0.4 RPL6P10 GC04M065667 EPHA5
GH04I065512 Enhancer 0.6 ENCODE 0.1 +157.4 157434 1 ZNF362 JUN USF2 CEBPB EP300 JUND BCL11A WT1 TCF7L2 SP7 GC04P065552 EPHA5 LOC105377256
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around EPHA5 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the EPHA5 gene promoter:

Genomic Locations for EPHA5 Gene

Genomic Locations for EPHA5 Gene
chr4:65,319,563-65,670,495
(GRCh38/hg38)
Size:
350,933 bases
Orientation:
Minus strand
chr4:66,185,281-66,536,213
(GRCh37/hg19)

Genomic View for EPHA5 Gene

Genes around EPHA5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
EPHA5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for EPHA5 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for EPHA5 Gene

Proteins for EPHA5 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for EPHA5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P54756-EPHA5_HUMAN
    Recommended name:
    Ephrin type-A receptor 5
    Protein Accession:
    P54756
    Secondary Accessions:
    • Q7Z3F2

    Protein attributes for EPHA5 Gene

    Size:
    1037 amino acids
    Molecular mass:
    114803 Da
    Quaternary structure:
    • Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).

    Three dimensional structures from OCA and Proteopedia for EPHA5 Gene

    Alternative splice isoforms for EPHA5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for EPHA5 Gene

Protein Expression for EPHA5 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for EPHA5 Gene

P54756:
  • MKLNTEVR
  • QLVGMLRG
  • RDLAARN
  • GAGEFGEV
  • RWTAPEAI
  • DTGGRKD
  • RKFTSASD
  • LEDDPEAAYTT
  • AHTNYTFE
  • TTNQAAPS
  • SVRVYYKKCP
  • GYTEKQRRDFL
  • GMKYLSDM
  • SDVWSYGI
  • MIVTEYMENGSLD
  • DTIAADE
  • LDKLIRNP
  • ALVSVRV
  • CTRPPSAP
  • KAKQDPEEEKM
  • QETSYTI
  • EGEWLVPIGKC
  • RARTAAGYG
  • LEGVVTKS
  • QAVHEFAKE
  • NLVCKVSDFGLSR
  • KFTLRDCNS
  • WTCLLLCAALR
  • LAFQDVGAC
  • GFYLAFQD
  • PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI
  • YVFQIRA
  • DGQFTVIQL
  • EEGYRLP
  • ISNVNETS
  • GRLKLPG
  • FSRRFEFET
  • EASIMGQF
  • NGVSDLS
  • EPDRPNG
  • FPDTITGADSSQLLEVSG
  • QLMLDCW
  • TYEDPNQAV
  • LMLDCWQK
  • DPHTYEDP
  • SYGERPYW
  • IMGQFDHPNII
  • LKLPGKR
  • DMGYVHRDLAARNIL

Post-translational modifications for EPHA5 Gene

  • Phosphorylated. Phosphorylation is stimulated by the ligand EFNA5. Dephosphorylation upon stimulation by glucose, inhibits EPHA5 forward signaling and results in insulin secretion (By similarity).
  • Glycosylation at posLast=264264, Asn299, posLast=369369, posLast=423423, posLast=436436, and posLast=461461

Other Protein References for EPHA5 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for EPHA5 Gene

Gene Families for EPHA5 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Protein Domains for EPHA5 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for EPHA5 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P54756

UniProtKB/Swiss-Prot:

EPHA5_HUMAN :
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
genes like me logo Genes that share domains with EPHA5: view

Function for EPHA5 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for EPHA5 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot Function:
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).

Enzyme Numbers (IUBMB) for EPHA5 Gene

Phenotypes From GWAS Catalog for EPHA5 Gene

Gene Ontology (GO) - Molecular Function for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity IEA --
GO:0004714 transmembrane receptor protein tyrosine kinase activity IEA --
GO:0005003 ephrin receptor activity IEA,ISS --
GO:0005004 GPI-linked ephrin receptor activity IEA,ISS --
genes like me logo Genes that share ontologies with EPHA5: view
genes like me logo Genes that share phenotypes with EPHA5: view

Animal Models for EPHA5 Gene

MGI Knock Outs for EPHA5:

Animal Model Products

Clone Products

  • Addgene plasmids for EPHA5

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EPHA5 Gene

Localization for EPHA5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for EPHA5 Gene

Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for EPHA5 gene
Compartment Confidence
plasma membrane 5
endoplasmic reticulum 5
nucleus 2
mitochondrion 1
cytosol 1

Gene Ontology (GO) - Cellular Components for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005791 rough endoplasmic reticulum IDA 10375373
GO:0005886 plasma membrane TAS --
GO:0005887 integral component of plasma membrane IEA --
GO:0005912 adherens junction IEA --
GO:0009897 external side of plasma membrane IDA 10064801
genes like me logo Genes that share ontologies with EPHA5: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for EPHA5 Gene

Pathways & Interactions for EPHA5 Gene

genes like me logo Genes that share pathways with EPHA5: view

SIGNOR curated interactions for EPHA5 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IEA --
GO:0007399 nervous system development IEA --
GO:0007411 axon guidance ISS,IEA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with EPHA5: view

Drugs & Compounds for EPHA5 Gene

Products:

  1. Drug

(5) Drugs for EPHA5 Gene - From: DrugBank, PharmGKB, FDA Approved Drugs, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dasatinib Approved, Investigational Pharma Target Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors 295
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3027
Sprycel Approved June 2006 Pharma 0
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for EPHA5 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with EPHA5: view

Transcripts for EPHA5 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for EPHA5 Gene

(12) REFSEQ mRNAs :
(7) Additional mRNA sequences :
(27) Selected AceView cDNA sequences:
(6) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for EPHA5 Gene

EPH receptor A5:
Representative Sequences:

Clone Products

  • Addgene plasmids for EPHA5

Alternative Splicing Database (ASD) splice patterns (SP) for EPHA5 Gene

No ASD Table

Relevant External Links for EPHA5 Gene

GeneLoc Exon Structure for
EPHA5
ECgene alternative splicing isoforms for
EPHA5

Expression for EPHA5 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for EPHA5 Gene

mRNA expression in normal human tissues for EPHA5 Gene
mRNA expression by GTEx for EPHA5 GenemRNA expression by BioGPS for EPHA5 Gene

mRNA differential expression in normal tissues according to GTEx for EPHA5 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x7.9), Brain - Hippocampus (x7.5), Brain - Anterior cingulate cortex (BA24) (x7.5), Brain - Amygdala (x5.7), and Brain - Cortex (x4.7).

Protein differential expression in normal tissues from HIPED for EPHA5 Gene

This gene is overexpressed in Fetal Brain (45.7) and Cerebrospinal fluid (19.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EPHA5 Gene



Protein tissue co-expression partners for EPHA5 Gene

NURSA nuclear receptor signaling pathways regulating expression of EPHA5 Gene:

EPHA5

SOURCE GeneReport for Unigene cluster for EPHA5 Gene:

Hs.654492

mRNA Expression by UniProt/SwissProt for EPHA5 Gene:

P54756-EPHA5_HUMAN
Tissue specificity: Almost exclusively expressed in the nervous system in cortical neurons, cerebellar Purkinje cells and pyramidal neurons within the cortex and hippocampus. Display an increasing gradient of expression from the forebrain to hindbrain and spinal cord.

Evidence on tissue expression from TISSUES for EPHA5 Gene

  • Nervous system(4.7)
  • Eye(4.3)
genes like me logo Genes that share expression patterns with EPHA5: view

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for EPHA5 Gene

Orthologs for EPHA5 Gene

This gene was present in the common ancestor of chordates.

Orthologs for EPHA5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia EPHA5 34 33
  • 99.58 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia EPHA5 34
  • 98 (a)
 OneToOne
LOC100337226 33
  • 94.5 (n)
dog
(Canis familiaris)
 Mammalia EPHA5 33 34
  • 95.32 (n)
oppossum
(Monodelphis domestica)
 Mammalia EPHA5 34
  • 95 (a)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia EPHA5 34
  • 95 (a)
 OneToOne
rat
(Rattus norvegicus)
 Mammalia Epha5 33
  • 91.1 (n)
mouse
(Mus musculus)
 Mammalia Epha5 16 34 33
  • 90.39 (n)
chicken
(Gallus gallus)
 Aves EPHA5 34 33
  • 83.9 (n)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia EPHA5 34
  • 93 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia epha5 33
  • 78.14 (n)
zebrafish
(Danio rerio)
 Actinopterygii CT990561.1 34
  • 79 (a)
 OneToOne
LOC797595 33
  • 72.52 (n)
Species where no ortholog for EPHA5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for EPHA5 Gene

ENSEMBL:
Gene Tree for EPHA5 (if available)
TreeFam:
Gene Tree for EPHA5 (if available)

Paralogs for EPHA5 Gene

Variants for EPHA5 Gene

Sequence variations from dbSNP and Humsavar for EPHA5 Gene

SNP ID Clin Chr 04 pos Variation AA Info Type
rs1057520012 likely-pathogenic, Adenocarcinoma of lung 65,404,419(-) C/T coding_sequence_variant, missense_variant
rs199614818 A lung adenocarcinoma sample 65,490,529(-) C/A/T coding_sequence_variant, intron_variant, missense_variant
VAR_042142 A lung large cell carcinoma sample p.Glu503Lys
VAR_042143 A lung adenocarcinoma sample p.Gly582Glu
VAR_042146 A lung squamous cell carcinoma sample p.Thr856Ile

Structural Variations from Database of Genomic Variants (DGV) for EPHA5 Gene

Variant ID Type Subtype PubMed ID
dgv2816n106 CNV deletion 24896259
esv1746107 CNV insertion 17803354
esv2021289 CNV deletion 18987734
esv2294940 CNV deletion 18987734
esv2422517 CNV duplication 17116639
esv24754 CNV loss 19812545
esv2501169 CNV deletion 19546169
esv2671686 CNV deletion 23128226
esv2676800 CNV deletion 23128226
esv2727747 CNV deletion 23290073
esv2727748 CNV deletion 23290073
esv2727749 CNV deletion 23290073
esv3383960 CNV insertion 20981092
esv3400337 CNV insertion 20981092
esv3600795 CNV loss 21293372
esv988089 CNV insertion 20482838
esv993892 CNV insertion 20482838
nsv1014463 CNV gain 25217958
nsv1114538 CNV deletion 24896259
nsv1149744 CNV deletion 26484159
nsv290967 CNV deletion 16902084
nsv291171 CNV insertion 16902084
nsv291266 CNV insertion 16902084
nsv470041 CNV loss 18288195
nsv475367 CNV novel sequence insertion 20440878
nsv507172 OTHER sequence alteration 20534489
nsv509905 OTHER sequence alteration 20534489
nsv818239 CNV gain 17921354
nsv980208 CNV duplication 23825009

Variation tolerance for EPHA5 Gene

Residual Variation Intolerance Score: 6.57% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.77; 66.62% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for EPHA5 Gene

Human Gene Mutation Database (HGMD)
EPHA5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
EPHA5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EPHA5 Gene

Disorders for EPHA5 Gene

MalaCards: The human disease database

(6) MalaCards diseases for EPHA5 Gene - From: HGMD, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
leber congenital amaurosis 17
  • lca17
acrodermatitis chronica atrophicans
  • herxheimer disease
drug-induced mental disorder
drug psychosis
  • drug-induced psychosis
lung large cell carcinoma
  • large cell carcinoma of lung
- elite association - COSMIC cancer census association via MalaCards
Search EPHA5 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for EPHA5

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with EPHA5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for EPHA5 Gene

Publications for EPHA5 Gene

  1. Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PMID: 9267020) (Cell 1997) 2 3 4 58
  2. Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure. (PMID: 22174851) Lingappa JR … Partners in Prevention HSV/HIV Transmission Study Team (PloS one 2011) 3 44 58
  3. Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer. (PMID: 19733895) Fu DY … Shao ZM (Human pathology 2010) 3 22 58
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
  5. Functional activation of EphA5 receptor does not promote cell proliferation in the aberrant EphA5 expressing human glioblastoma U-118 MG cell line. (PMID: 10064801) Bruce V … Miescher GC (Brain research 1999) 3 22 58

Products for EPHA5 Gene

  • Addgene plasmids for EPHA5

Sources for EPHA5 Gene

Content
Loading form....