Aliases for EPHA5 Gene
Aliases for EPHA5 Gene
External Ids for EPHA5 Gene
- HGNC: 3389
- Entrez Gene: 2044
- Ensembl: ENSG00000145242
- OMIM: 600004
- UniProtKB: P54756
Previous GeneCards Identifiers for EPHA5 Gene
- GC04U990011
- GC04M066173
- GC04M066193
- GC04M066014
- GC04M065872
- GC04M062095
Summaries for EPHA5 Gene
-
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]
GeneCards Summary for EPHA5 Gene
EPHA5 (EPH Receptor A5) is a Protein Coding gene. Diseases associated with EPHA5 include Leber Congenital Amaurosis 17 and Acrodermatitis Chronica Atrophicans. Among its related pathways are Development Slit-Robo signaling and EPH-Ephrin signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3.
UniProtKB/Swiss-Prot for EPHA5 Gene
-
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).
-
Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EPHA5 Gene
Genomics for EPHA5 Gene
GeneHancer (GH) Regulatory Elements for EPHA5 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH04I065667 | Promoter/Enhancer | 2.2 | EPDnew FANTOM5 Ensembl ENCODE | 562.8 | +1.1 | 1146 | 3.7 | CTCF MXI1 USF1 ZBTB6 MAX MZF1 ZNF76 ZIC2 ZNF335 ZFHX2 | EPHA5 EPHA5-AS1 GC04M065667 | |
GH04I066095 | Enhancer | 0.2 | Ensembl | 10.4 | -423.9 | -423906 | 0.4 | LOC728048 EPHA5 GC04P066168 ENSG00000249413 | ||
GH04I066123 | Enhancer | 0.4 | VISTA | 4.3 | -453.7 | -453710 | 0.9 | EPHA5 LOC728048 GC04P066168 ENSG00000249413 | ||
GH04I065573 | Promoter | 0.5 | Ensembl | 0.2 | +96.9 | 96894 | 0.4 | RPL6P10 GC04M065667 EPHA5 | ||
GH04I065512 | Enhancer | 0.6 | ENCODE | 0.1 | +157.4 | 157434 | 1 | ZNF362 JUN USF2 CEBPB EP300 JUND BCL11A WT1 TCF7L2 SP7 | GC04P065552 EPHA5 LOC105377256 |
Regulatory Element Products
Genomic Locations for EPHA5 Gene
- chr4:65,319,563-65,670,495
- (GRCh38/hg38)
- Size:
- 350,933 bases
- Orientation:
- Minus strand
- chr4:66,185,281-66,536,213
- (GRCh37/hg19)
Genomic View for EPHA5 Gene
- Cytogenetic band:
-
- 4q13.2 by Ensembl
- 4q13.1-q13.2 by Entrez Gene
- 4q13.1-q13.2 by HGNC


RefSeq DNA sequence for EPHA5 Gene
Proteins for EPHA5 Gene
-
Protein details for EPHA5 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P54756-EPHA5_HUMAN
- Recommended name:
- Ephrin type-A receptor 5
- Protein Accession:
- P54756
- Q7Z3F2
Protein attributes for EPHA5 Gene
- Size:
- 1037 amino acids
- Molecular mass:
- 114803 Da
- Quaternary structure:
-
- Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).
Protein Expression for EPHA5 Gene
Selected DME Specific Peptides for EPHA5 Gene
- P54756:
-
- MKLNTEVR
- QLVGMLRG
- RDLAARN
- GAGEFGEV
- RWTAPEAI
- DTGGRKD
- RKFTSASD
- LEDDPEAAYTT
- AHTNYTFE
- TTNQAAPS
- SVRVYYKKCP
- GYTEKQRRDFL
- GMKYLSDM
- SDVWSYGI
- MIVTEYMENGSLD
- DTIAADE
- LDKLIRNP
- ALVSVRV
- CTRPPSAP
- KAKQDPEEEKM
- QETSYTI
- EGEWLVPIGKC
- RARTAAGYG
- LEGVVTKS
- QAVHEFAKE
- NLVCKVSDFGLSR
- KFTLRDCNS
- WTCLLLCAALR
- LAFQDVGAC
- GFYLAFQD
- PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI
- YVFQIRA
- DGQFTVIQL
- EEGYRLP
- ISNVNETS
- GRLKLPG
- FSRRFEFET
- EASIMGQF
- NGVSDLS
- EPDRPNG
- FPDTITGADSSQLLEVSG
- QLMLDCW
- TYEDPNQAV
- LMLDCWQK
- DPHTYEDP
- SYGERPYW
- IMGQFDHPNII
- LKLPGKR
- DMGYVHRDLAARNIL
Post-translational modifications for EPHA5 Gene
- Phosphorylated. Phosphorylation is stimulated by the ligand EFNA5. Dephosphorylation upon stimulation by glucose, inhibits EPHA5 forward signaling and results in insulin secretion (By similarity).
- Glycosylation at posLast=264264, Asn299, posLast=369369, posLast=423423, posLast=436436, and posLast=461461
Other Protein References for EPHA5 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for EPHA5 (EphA5)
- Cell Signaling Technology (CST) Antibodies for EPHA5 (EphA5)
-
Custom Antibody ServicesOriGene Antibodies for EPHA5
- Novus Biologicals Antibodies for EPHA5
-
Abcam antibodies for EPHA5
- Invitrogen Antibodies for EPHA5
- GeneTex EPHA5 antibody for EPHA5
-
Santa Cruz Biotechnology (SCBT) Antibodies for EPHA5
Protein Products
- R&D Systems Proteins and Enzymes for EPHA5 (EphA5)
-
OriGene Purified Proteins for EPHA5
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA5
- Origene Custom Protein Services for EPHA5
- Search GeneTex for Proteins for EPHA5
-
Abcam proteins for EPHA5
Assay Products
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA5 (EphA5)
Domains & Families for EPHA5 Gene
Gene Families for EPHA5 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted membrane proteins
Protein Domains for EPHA5 Gene
- InterPro:
-
- Ig-like_fold
- Kinase-like_dom_sf
- Prot_kinase_dom
- Protein_kinase_ATP_BS
- Ser-Thr/Tyr_kinase_cat_dom
- Tyr_kinase_AS
- FN3_dom
- FN3_sf
- Tyr_kinase_cat_dom
- Galactose-bd-like_sf
- SAM/pointed_sf
- SAM
- Tyr_kinase_ephrin_rcpt
- Eph_TM
- Ephrin_rcpt_lig-bd_dom
- Tyr-kin_ephrin_A/B_rcpt-like
- Tyr_kinase_rcpt_V_CS
- EphA5_rcpt_lig-bd
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for EPHA5 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P54756UniProtKB/Swiss-Prot:
EPHA5_HUMAN :- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Function for EPHA5 Gene
Molecular function for EPHA5 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
- UniProtKB/Swiss-Prot Function:
- Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).
Enzyme Numbers (IUBMB) for EPHA5 Gene
Phenotypes From GWAS Catalog for EPHA5 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004713 | protein tyrosine kinase activity | IEA | -- |
GO:0004714 | transmembrane receptor protein tyrosine kinase activity | IEA | -- |
GO:0005003 | ephrin receptor activity | IEA,ISS | -- |
GO:0005004 | GPI-linked ephrin receptor activity | IEA,ISS | -- |
Phenotypes for EPHA5 Gene
- MGI mutant phenotypes for EPHA5:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for EPHA5:
Animal Models for EPHA5 Gene
- MGI Knock Outs for EPHA5:
-
- Epha5 tm1Jgf
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA5
-
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
- Search ViGene Biosciences for EPHA5
CRISPR Products
-
OriGene CRISPR knockouts for EPHA5
- Applied Biological Materials CRISPR for EPHA5
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
miRNA for EPHA5 Gene
- miRTarBase miRNAs that target EPHA5
-
- hsa-mir-34a-5p (MIRT006576)
- hsa-mir-181a-5p (MIRT025144)
- hsa-mir-574-5p (MIRT523880)
- hsa-mir-1277-5p (MIRT523881)
- hsa-mir-5010-3p (MIRT523882)
- hsa-mir-147a (MIRT523883)
- hsa-mir-6818-5p (MIRT523884)
- hsa-mir-297 (MIRT523885)
- hsa-mir-190a-3p (MIRT523886)
- hsa-mir-6867-5p (MIRT523887)
- hsa-mir-223-5p (MIRT523888)
- hsa-mir-567 (MIRT523889)
- hsa-mir-511-3p (MIRT523890)
- hsa-mir-5011-5p (MIRT542992)
miRNA Products
- Search ViGene Biosciences for EPHA5
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
- genomics-online: shRNA clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
Clone Products
-
OriGene ORF clones in human for EPHA5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA5
- genomics-online: cdna clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- orf clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- Applied Biological Materials Clones for EPHA5
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
- ESI BIO PureStem E15, Meso-prx/latp Progenitor for EPHA5
-
Horizon Cell Lines for EPHA5
-
ViGene Biosciences adenoviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EPHA5 Gene
Localization for EPHA5 Gene
Subcellular locations from UniProtKB/Swiss-Prot for EPHA5 Gene
- Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005791 | rough endoplasmic reticulum | IDA | 10375373 |
GO:0005886 | plasma membrane | TAS | -- |
GO:0005887 | integral component of plasma membrane | IEA | -- |
GO:0005912 | adherens junction | IEA | -- |
GO:0009897 | external side of plasma membrane | IDA | 10064801 |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for EPHA5 Gene
Pathways & Interactions for EPHA5 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | GPCR Pathway |
.73
.62
|
.55
|
2 | EPHA forward signaling | ||
3 | ERK Signaling |
.61
.58
|
.49
|
4 | Nanog in Mammalian ESC Pluripotency |
.61
|
.48
|
5 | Actin Nucleation by ARP-WASP Complex |
.41
|
Pathways by source for EPHA5 Gene
1 Cell Signaling Technology pathway for EPHA5 Gene
3 BioSystems pathways for EPHA5 Gene
5 Reactome pathways for EPHA5 Gene
1 KEGG pathway for EPHA5 Gene
3 GeneGo (Thomson Reuters) pathways for EPHA5 Gene
Interacting Proteins for EPHA5 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | IEA | -- |
GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | IEA | -- |
GO:0007399 | nervous system development | IEA | -- |
GO:0007411 | axon guidance | ISS,IEA | -- |
GO:0016310 | phosphorylation | IEA | -- |
Drugs & Compounds for EPHA5 Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Dasatinib | Approved, Investigational | Pharma | Target | Kinase Inhibitors, SRC/BCR-ABL tyrosine kinase inhibitors | 295 | |
Paclitaxel | Approved, Vet_approved | Pharma | Tubulin and Bcl2 inhibitor, Taxanes | 3027 | ||
Sprycel | Approved June 2006 | Pharma | 0 | |||
ATP | Investigational | Nutra | Agonist | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for EPHA5 Gene
mRNA/cDNA for EPHA5 Gene
- (12) REFSEQ mRNAs :
- (7) Additional mRNA sequences :
- (27) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for EPHA5
- Applied Biological Materials CRISPR for EPHA5
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
miRNA Products
- Search ViGene Biosciences for EPHA5
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
- genomics-online: shRNA clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
Clone Products
-
OriGene ORF clones in human for EPHA5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA5
- genomics-online: cdna clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- orf clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- Applied Biological Materials Clones for EPHA5
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Expression for EPHA5 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Blood (Hematopoietic System)
- Mesenchymal Stem Cells
- Umbilical Cord (Extraembryonic Tissues)
-
Ovary (Reproductive System)
- Cumulus Cells Antral Follicle
-
Peripheral Nervous System (Nervous System)
- Immature Schwann Cells Peripheral Nerve Domain
-
Limb (Muscoskeletal System)
- Limb Muscle Progenitor Cells Forelimb Myotome
-
Skeletal Muscle (Muscoskeletal System)
- Limb Muscle Progenitor Cells Forelimb Myotome
-
Pancreas (Endocrine System)
- Mature Beta Cells Islets of Langerhans
- Lateral Plate Mesoderm (Gastrulation Derivatives)
- Paraxial Mesoderm (Gastrulation Derivatives)
-
Brain (Nervous System)
mRNA differential expression in normal tissues according to GTEx for EPHA5 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EPHA5 Gene
NURSA nuclear receptor signaling pathways regulating expression of EPHA5 Gene:
EPHA5SOURCE GeneReport for Unigene cluster for EPHA5 Gene:
Hs.654492mRNA Expression by UniProt/SwissProt for EPHA5 Gene:
P54756-EPHA5_HUMANEvidence on tissue expression from TISSUES for EPHA5 Gene
- Nervous system(4.7)
- Eye(4.3)
Primer Products
-
OriGene qPCR primer pairs for EPHA5
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for EPHA5 Gene
Orthologs for EPHA5 Gene
This gene was present in the common ancestor of chordates.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | EPHA5 34 33 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | EPHA5 34 |
|
OneToOne | |
LOC100337226 33 |
|
||||
dog (Canis familiaris) |
Mammalia | EPHA5 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | EPHA5 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | EPHA5 34 |
|
OneToOne | |
rat (Rattus norvegicus) |
Mammalia | Epha5 33 |
|
||
mouse (Mus musculus) |
Mammalia | Epha5 16 34 33 |
|
||
chicken (Gallus gallus) |
Aves | EPHA5 34 33 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | EPHA5 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | epha5 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | CT990561.1 34 |
|
OneToOne | |
LOC797595 33 |
|
- Species where no ortholog for EPHA5 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for EPHA5 Gene
Paralogs for EPHA5 Gene
(47) SIMAP similar genes for EPHA5 Gene using alignment to 5 proteins:
- EPHA3
- EPHA4
- EPHA6
- EPHA7
- EPHB1
- EPHB2
- ABL1
- EPHA8
- EPHB2 variant protein
- EPHA2
- EPHB3
- FGR
- FES
- tec
- EPHA10
- FYN
- SRC
- MET
- HCK
- SRMS
- BTK kinase deficient isoform 6
- EPHA1
- LCK
- EPHB4
- BRAF
- BLK
- YES1
- LYN
- FRK
- EPHB6
- DKFZp434L0319
- CSK
- TXK
- TNK2
- MST1R
- PTK7
- PTK6
- BTK kinase deficient isoform 4
- BTK kinase deficient isoform 2
- ERBB4
- urf-ret
- BTK
- FGFR2
- DKFZp686M05208
- CAMK1
- NUAK1
- FGFR1
Variants for EPHA5 Gene
SNP ID | Clin | Chr 04 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1057520012 | likely-pathogenic, Adenocarcinoma of lung | 65,404,419(-) | C/T | coding_sequence_variant, missense_variant | |
rs199614818 | A lung adenocarcinoma sample | 65,490,529(-) | C/A/T | coding_sequence_variant, intron_variant, missense_variant | |
VAR_042142 | A lung large cell carcinoma sample | p.Glu503Lys | |||
VAR_042143 | A lung adenocarcinoma sample | p.Gly582Glu | |||
VAR_042146 | A lung squamous cell carcinoma sample | p.Thr856Ile |
Additional Variant Information for EPHA5 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EPHA5 Gene
Disorders for EPHA5 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
leber congenital amaurosis 17 |
|
|
acrodermatitis chronica atrophicans |
|
|
drug-induced mental disorder |
|
|
drug psychosis |
|
|
lung large cell carcinoma |
|
|
Additional Disease Information for EPHA5
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for EPHA5 Gene
Publications for EPHA5 Gene
- Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PMID: 9267020) (Cell 1997) 2 3 4 58
- Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure. (PMID: 22174851) Lingappa JR … Partners in Prevention HSV/HIV Transmission Study Team (PloS one 2011) 3 44 58
- Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer. (PMID: 19733895) Fu DY … Shao ZM (Human pathology 2010) 3 22 58
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
- Functional activation of EphA5 receptor does not promote cell proliferation in the aberrant EphA5 expressing human glioblastoma U-118 MG cell line. (PMID: 10064801) Bruce V … Miescher GC (Brain research 1999) 3 22 58
Products for EPHA5 Gene
- R&D Systems Antibodies for EPHA5 (EphA5)
- R&D Systems Proteins and Enzymes for EPHA5 (EphA5)
- R&D Systems Proteome Profiler Antibody Arrays and other biochemical assays for EPHA5 (EphA5)
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for EPHA5
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for EPHA5
- Search Origene for MassSpec and Protein Over-expression Lysates for EPHA5
- Origene Custom Protein Services for EPHA5
- Origene shrna, sirna, and RNAi products in human, mouse, rat for EPHA5
- Browse OriGene Inhibitory RNA Products For EPHA5
- OriGene qPCR primer pairs for EPHA5
- OriGene CRISPR knockouts for EPHA5
- OriGene ORF clones in human for EPHA5
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For EPHA5
- GenScript: Next-day shipping of latest version cDNA ORF clones for EPHA5 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for EPHA5
- GenScript Custom Assay Services for EPHA5
- GenScript Custom overexpressing Cell Line Services for EPHA5
- GenScript: Design CRISPR guide RNA sequences for EPHA5
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for EPHA5
- Cell Signaling Technology (CST) Antibodies for EPHA5 (EphA5)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for EPHA5
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for EPHA5
- Abcam proteins for EPHA5
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- ESI BIO PureStem E15, Meso-prx/latp Progenitor for EPHA5
- Invitrogen Antibodies for EPHA5
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for EPHA5
- VectorBuilder custom plasmid, inducible vectors for EPHA5
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for EPHA5
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for EPHA5
- antibodies-online: Search results for 139 available EPH Receptor A5 Antibodies ranked by validation data
- Compare Top EPH Receptor A5 Antibodies
- antibodies-online: Search results for 5 available EPH Receptor A5 Elisa Kits ranked by validation data
- Compare Top EPH Receptor A5 Elisa Kits
- antibodies-online: Search results for 12 available EPH Receptor A5 Proteins ranked by validation data
- Compare Top EPH Receptor A5 Proteins
- GeneTex EPHA5 antibody for EPHA5
- Search GeneTex for Proteins for EPHA5
- ViGene Biosciences adenoviral particle packaged cDNA for EPHA5 gene
- ViGene Biosciences lentiviral particle packaged cDNA for EPHA5 gene
- ViGene Biosciences ready-to-package AAV shRNAs for EPHA5 gene
- Search ViGene Biosciences for EPHA5
- Santa Cruz Biotechnology (SCBT) Antibodies for EPHA5
- Search Santa Cruz Biotechnology (SCBT) for EPHA5 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for EPHA5
- Horizon Cell Lines for EPHA5
- genomics-online: cdna clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- orf clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- genomics-online: gRNA clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- genomics-online: primer clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
- genomics-online: shRNA clones - Search results for 97 available EPH Receptor A5 gene related products
- Overview of 97 available EPH Receptor A5 gene related products
Sources for EPHA5 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew