Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

EPHA5 Gene

protein-coding   GIFtS: 63
GCID: GC04M066193

EPH receptor A5

(Previous name: EphA5 )
 Explore 9 diseases affiliated with
EPHA5 via our new
 Human Malady Compendium 
Biological research products
for EPHA5
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
EPH Receptor A51 2     EC 2.7.10.13 8
TYRO41 2 3 5     EphA51
EHK11 2 3     Hek71
HEK72 3 5     Eph Homology Kinase-12
CEK71 2     Ephrin Type-A Receptor 52
Brain-Specific Kinase2 3     Receptor Protein-Tyrosine Kinase HEK72
EHK-12 3     Tyrosine-Protein Kinase Receptor EHK-12
EK72 3     BSK3
EPH Homology Kinase 12 3     HEK72 3 5
EPH-Like Kinase 72 3     EC 2.7.108

External Ids:    HGNC: 33891   Entrez Gene: 20442   Ensembl: ENSG000001452427   OMIM: 6000045   UniProtKB: P547563   

Export aliases for EPHA5 gene to outside databases

Previous GC identifers: GC04U990011 GC04M066173 GC04M066014 GC04M065872 GC04M062095


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for EPHA5:
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors
have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH
subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2
fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their
extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants
encoding different isoforms have been found for this gene. (provided by RefSeq, Jan 2009)

UniProtKB/Swiss-Prot: EPHA5_HUMAN, P54756
Function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent
cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream
of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is
referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the
cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in
the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays
also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. Beside its function in the
nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate
glucose-stimulated insulin secretion (By similarity)

Gene Wiki entry for EPHA5 (EPH receptor A5)


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000004.11  NC_018915.1  NT_022778.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the EPHA5 gene promoter:
         C/EBPbeta   p53   Pbx1a   ATF-2   Nkx2-2   CRE-BP1   FOXJ2 (long isoform)   FOXJ2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidEPHA5 promoter sequence
   Search SABiosciences Chromatin IP Primers for EPHA5

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat EPHA5


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 4q13.1   Ensembl cytogenetic band:  4q13.1   HGNC cytogenetic band: 4q13.1

EPHA5 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
EPHA5 gene location

GeneLoc information about chromosome 4         GeneLoc Exon Structure

GeneLoc location for GC04M066193:  view genomic region     (about GC identifiers)

Start:
66,185,281 bp from pter      End:
66,536,213 bp from pter
Size:
350,933 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: EPHA5_HUMAN, P54756 (See protein sequence)
Recommended Name: Ephrin type-A receptor 5 precursor  
Size: 1037 amino acids; 114803 Da
Subunit: Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor
dimer. Oligomerization is probably required to induce biological responses (By similarity)
Subcellular location: Cell membrane (By similarity); Single-pass type I membrane protein (By similarity). Cell
projection, axon (By similarity). Cell projection, dendrite
1 PDB 3D structure from and Proteopedia for EPHA5:
2R2P (3D)    
Secondary accessions: Q7Z3F2
Alternative splicing: 3 isoforms:  P54756-1   P54756-2   P54756-3   

Explore the universe of human proteins at neXtProt for EPHA5: NX_P54756

Post-translational modifications:

  • Phosphorylated. Phosphorylation is stimulated by the ligand EFNA5. Dephosphorylation upon stimulation by glucose,
  • inhibits EPHA5 forward signaling and results in insulin secretion (By similarity)1
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P54756

  • 49 DME Specific Peptides for EPHA5 (P54756) (see first 4)
     RDLAARN  DTGGRKD  YVFQIRA  EEGYRLP 
     GRLKLPG  NGVSDLS  DTIAADE  EPDRPNG 
     ALVSVRV  QETSYTI  QLMLDCW  LKLPGKR 
     MKLNTEVR  QLVGMLRG  GAGEFGEV  RWTAPEAI 
     RKFTSASD  AHTNYTFE  TTNQAAPS  GFYLAFQD 
     GMKYLSDM  ISNVNETS  EASIMGQF  SDVWSYGI 
     LDKLIRNP  CTRPPSAP  LMLDCWQK  SYGERPYW 
     DPHTYEDP  LEGVVTKS  KFTLRDCNS  LAFQDVGAC 
     DGQFTVIQL  FSRRFEFET  TYEDPNQAV  RARTAAGYG 
     QAVHEFAKE  SVRVYYKKCP  WTCLLLCAALR  LEDDPEAAYTT 
     GYTEKQRRDFL  KAKQDPEEEKM  EGEWLVPIGKC  IMGQFDHPNII 
     NLVCKVSDFGLSR  MIVTEYMENGSLD  DMGYVHRDLAARNIL  FPDTITGADSSQLLEVSG 
     PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI 

    EPHA5 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (2 alternative transcripts): 
    NP_004430.4  NP_872272.2  

    ENSEMBL proteins: 
     ENSP00000273854   ENSP00000389208   ENSP00000346899   ENSP00000427638  

    Human Recombinant Protein Products: 
    EMD Millipore Purified and/or Recombinant EPHA5 Protein
    R&D Systems Recombinant & Natural Proteins for EPHA5
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate: EPHA5
    OriGene Custom Protein Services for EPHA5 
    GenScript Custom Purified and Recombinant Proteins Services for EPHA5
    Novus Biologicals EPHA5 Proteins
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for EPHA5

    Gene Ontology (GO): 5/9 cellular component terms (GO ID links to tree view) (see all 9):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005791rough endoplasmic reticulum IDA10375373
    GO:0005886plasma membrane IDA10375373
    GO:0005887integral to plasma membrane IEA--
    GO:0009897external side of plasma membrane IDA10064801
    GO:0016021integral to membrane ----


    EPHA5 for ontologies           About GeneDecksing



    EPHA5 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    R&D Systems Antibodies for EPHA5
    Cell Signaling Technology (CST) Antibodies for EPHA5 
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for EPHA5 
    GenScript Custom Superior Antibodies Services for EPHA5
    Novus Biologicals EPHA5 Antibodies
    Search for Antibodies for EPHA5 at Abcam  
    Uscn Antibodies for EPHA5
    ThermoFisher Antibodies for EPHA5

    Assay Products for EPHA5: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    R&D Systems ELISAs for EPHA5         (see all)
    GenScript EPHA5-Activity-based Kinase Assay for Compound Screening
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for EPHA5


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    EPHA5 for domains           About GeneDecksing

    5/15 InterPro domains/families (see all 15):
     IPR017441 Protein_kinase_ATP_BS
     IPR013761 SAM/pointed
     IPR001660 SAM
     IPR001245 Ser-Thr/Tyr_kinase_cat_dom
     IPR003961 Fibronectin_type3

    Graphical View of Domain Structure for InterPro Entry P54756

    ProtoNet protein and cluster: P54756

    5 Blocks protein families:
    IPB001090 Ephrin receptor
    IPB001426 Receptor tyrosine kinase
    IPB001660 Sterile alpha motif SAM
    IPB003962 Fibronectin type III repeat signature
    IPB008266 Tyrosine protein kinase


    UniProtKB/Swiss-Prot: EPHA5_HUMAN, P54756
    Similarity: Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily
    Similarity: Contains 1 Eph LBD (Eph ligand-binding) domain
    Similarity: Contains 2 fibronectin type-III domains
    Similarity: Contains 1 protein kinase domain
    Similarity: Contains 1 SAM (sterile alpha motif) domain


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: EPHA5_HUMAN, P54756
    Function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent
    cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream
    of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is
    referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the
    cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in
    the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays
    also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. Beside its function in the
    nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate
    glucose-stimulated insulin secretion (By similarity)
    Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate

    Enzyme Numbers (IUBMB): EC 2.7.10.11 2 EC 2.7.102

    miRNA
    Products:
        
    OriGene 3'-UTR Clone (see all 2): EPHA5
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat EPHA5
    8/99 QIAGEN miScript miRNA Assays for microRNAs that regulate EPHA5 (see all 99):
    hsa-miR-323-3p hsa-miR-520e hsa-miR-4272 hsa-miR-106a hsa-miR-200a hsa-miR-605 hsa-miR-938 hsa-miR-519a
    SwitchGear 3'UTR luciferase reporter plasmidEPHA5 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA5 (see all 3)
    OriGene shRNA RFP: EPHA5
    OriGene siRNA: EPHA5
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA5

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for EPHA5

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5 (see all 5)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5 (see all 5)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): EPHA5 (NM_004439)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for EPHA5
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA5 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for EPHA5
    LifeMap BioReagents: cell line associated with EPHA5: PureStem E15, Meso-prx/latp Progenitor

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA5

    Gene Ontology (GO): 5 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005003ephrin receptor activity ISS--
    GO:0005004GPI-linked ephrin receptor activity ISS--
    GO:0005005transmembrane-ephrin receptor activity NAS7898931
    GO:0005515protein binding ----
    GO:0005524ATP binding IEA--


    EPHA5 for ontologies           About GeneDecksing


    Animal Models:
         1 MGI mutant phenotype (inferred from 1 allele(MGI details for Epha5):
     nervous system 

    EPHA5 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/20 super-pathways (see all 20About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1GPCR Pathway
    GPCR Pathway1.00
    Estrogen Pathway0.55
    Ras Pathway0.62
    Pancreatic Adenocarcinoma0.55
    Breast Cancer Regulation by Stathmin10.58
    Paxillin Interactions0.53
    NFAT in Immune Response0.58
    P2Y Receptor Signaling0.38
    2Rho Family GTPases
    Rho Family GTPases1.00
    MAPK Signaling0.51
    ERK Signaling0.61
    ILK Signaling0.45
    Molecular Mechanisms of Cancer0.51
    3Nanog in Mammalian ESC Pluripotency
    Nanog in Mammalian ESC Pluripotency1.00
    14-3-3 Induced Intracellular Signaling0.59
    GSK3 Signaling0.61
    eNOS Signaling0.48
    4Actin Nucleation by ARP-WASP Complex
    Actin Nucleation by ARP-WASP Complex1.00
    CDC42 Pathway0.34
    Actin Nucleation and Branching0.66
    5G-protein signaling_RhoA regulation pathway
    G-protein signaling_RhoA regulation pathway1.00
    EphrinA-EphR Signaling0.26
    G-protein signaling RhoA regulation pathway1.00

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    3 EMD Millipore Pathways for EPHA5
        Neurophysiological process Receptor-mediated axon growth repulsion
    Cell adhesion Ephrins signaling
    G-protein signaling RhoA regulation pathway

    5/32 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for EPHA5 (see all 32)
        Paxillin Interactions
    Molecular Mechanisms of Cancer
    Intracellular Calcium Signaling
    JNK Pathway
    P2Y Receptor Signaling

    1 Cell Signaling Technology (CST) Pathway for EPHA5
        Tyrosine Kinases / Adaptors

    3 GeneGo (Thomson Reuters) Pathways for EPHA5
        Neurophysiological process Receptor-mediated axon growth repulsion
    G-protein signaling RhoA regulation pathway
    Cell adhesion Ephrins signaling

    3 BioSystems Pathways for EPHA5 
        EPHA forward signaling
    Ephrin A reverse signaling
    EphrinA-EPHA pathway


    1         Kegg Pathway  (Kegg details for EPHA5):
        Axon guidance


    EPHA5 for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for EPHA5

    STRING Interaction Network Preview (showing 5 interactants - click image to see 23)

    5/25 Interacting proteins for EPHA5 (P547563 ENSP000002738544) via UniProtKB, MINT, STRING, and/or I2D (see all 25)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    EFNA2O439213, ENSP000002153684I2D: score=2 STRING: ENSP00000215368
    EFNA5P528033, ENSP000003287774I2D: score=2 STRING: ENSP00000328777
    EFNA1P208273, ENSP000003573924I2D: score=1 STRING: ENSP00000357392
    EFNA3P527973, ENSP000003573934I2D: score=1 STRING: ENSP00000357393
    STAT3P407633, ENSP000002646574I2D: score=1 STRING: ENSP00000264657
    About this table

    Gene Ontology (GO): 5/11 biological process terms (GO ID links to tree view) (see all 11):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0007411axon guidance ISS--
    GO:0019933cAMP-mediated signaling ISS--
    GO:0021766hippocampus development ISS--
    GO:0032314regulation of Rac GTPase activity ISS--
    GO:0032793positive regulation of CREB transcription factor activity ISS--


    EPHA5 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    EPHA5 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for EPHA5

    2 HMDB Compounds for EPHA5    About this table
    CompoundSynonyms CAS #PubMed Ids
    ADPadenosindiphosphorsaeure (see all 8)58-64-0--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    1 Novoseek chemical compound relationship for EPHA5 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    tyrosine 31.9 2 10064801 (1), 19733895 (1)

    Search CenterWatch for drugs/clinical trials and news about EPHA5 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for EPHA5 gene (2 alternative transcripts): 
    NM_004439.5  NM_182472.2  

    Unigene Cluster for EPHA5:

    EPH receptor A5
    Hs.654492  [show with all ESTs]
    Unigene Representative Sequence: NM_004439
    4 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000273854(uc003hcx.3 uc003hcy.3 uc003hcz.3 uc011cah.2 uc011cai.2)
    ENST00000432638 ENST00000354839 ENST00000511294(uc003hda.2)

    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 2): EPHA5
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat EPHA5
    8/99 QIAGEN miScript miRNA Assays for microRNAs that regulate EPHA5 (see all 99):
    hsa-miR-323-3p hsa-miR-520e hsa-miR-4272 hsa-miR-106a hsa-miR-200a hsa-miR-605 hsa-miR-938 hsa-miR-519a
    SwitchGear 3'UTR luciferase reporter plasmidEPHA5 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA5 (see all 3)
    OriGene shRNA RFP: EPHA5
    OriGene siRNA: EPHA5
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA5
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5 (see all 5)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5 (see all 5)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): EPHA5 (NM_004439)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for EPHA5
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA5 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA5
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat EPHA5
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA5
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA5

    Additional cDNA sequence: 

    AB209375.1 AK307826.1 BC136257.1 BC136258.1 BC143427.1 BX537946.1 L36644.1 

    4 DOTS entries:

    DT.65287326  DT.95152379  DT.407663  DT.95153288 

    24/27 AceView cDNA sequences (see all 27):

    BX642416 BM693322 BX102577 BE219686 H11658 D81888 BM664168 AA121200 
    BX505546 BX477839 D82015 AI867137 BF433558 AV718336 BE218107 AI697835 
    T07343 T06040 AI694040 AW341789 H12187 BX537946 BG925074 NM_004439 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    EPHA5 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: --

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    EPHA5 expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    5 LifeMap In Vivo Development Anatomical Compartments/Cells 
    Tissue Anatomical Compartment CellCategory (developmental path)
    PancreasIslets of LangerhansMature Beta CellsPancreas
    OvaryAntral FollicleCumulus CellsOvary
    BrainThalamusBrain
    Neural TubeDiencephalonNeural Tube
    Neural TubeTelencephalonNeural Tube
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization
    Stem Cell Differentiation: 6 LifeMap Cells 
    NameCategory
    PureStem™ progenitor T42 (Embryonic Progenitor Cell)
    PureStem™ mesenchymal progenitor SM30 (Embryonic Progenitor Cell)Adipose, Bone, Cartilage
    PureStem™ mesenchymal progenitor E15 (Embryonic Progenitor Cell)Adipose, Bone, Cartilage
    PureStem™ progenitor E69 (Embryonic Progenitor Cell)
    PureStem™ progenitor T36 (Embryonic Progenitor Cell)
    PureStem™ progenitor U31 (Embryonic Progenitor Cell)

    See EPHA5 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for EPHA5

    SOURCE GeneReport for Unigene cluster: Hs.654492

    UniProtKB/Swiss-Prot: EPHA5_HUMAN, P54756
    Tissue specificity: Almost exclusively expressed in the nervous system in cortical neurons, cerebellar Purkinje cells
    and pyramidal neurons within the cortex and hippocampus. Display an increasing gradient of expression from the
    forebrain to hindbrain and spinal cord

        SABiosciences Custom PCR Arrays for EPHA5
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA5
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat EPHA5
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA5
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA5
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA5

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for EPHA5 gene from 6/20 species (see all 20)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Epha51 , 5 Eph receptor A51, 5 90.35(n)1
    96.12(a)1
      5 (43.00 cM)5
    138391  NM_007937.31  NP_031963.21 
     840577915 
    chicken
    (Gallus gallus)
    Aves EPHA51 EPH receptor A5 83.93(n)
    93.53(a)
      395997  NM_205105.2  NP_990436.2 
    lizard
    (Anolis carolinensis)
    Reptilia EPHA56
    --
    93(a)
    1 ↔ 1
    GL343345.1(579411-856437)
    zebrafish
    (Danio rerio)
    Actinopterygii LOC7975951 ephrin type-A receptor 5-like 72.55(n)
    79.67(a)
      797595  XM_001338028.4  XP_001338064.4 
    fruit fly
    (Drosophila melanogaster)
    Insecta Eph6
    Eph receptor tyrosine kinase
    37(a)
    1 → many
    4(631310-643096)
    worm
    (Caenorhabditis elegans)
    Secernentea vab-16
    Y116A8C.386
    (see all 6)
    --
    28(a)
    18(a)
    (see all 6)
    possible ortholog
    possible ortholog
    (see all 6)
    II(4571997-4591357)
    IV(17131509-17137510)


    ENSEMBL Gene Tree for EPHA5 (if available)
    TreeFam Gene Tree for EPHA5 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for EPHA5 gene
    EPHB12  EPHA22  EPHB32  EPHA42  EPHB62  EPHA62  EPHB22  EPHA12  
    EPHA82  EPHA32  EPHA72  EPHB42  EPHA102  
    18/49 SIMAP similar genes for EPHA5 using alignment to 5 protein entries:     EPHA5_HUMAN (see all proteins) (see all similar genes):
    EPHA3    EPHA4    EPHA6    EPHA7    EPHB1    EPHB2
    ABL1    EPHA8    EPHB2 variant protein    EPHA2    EPHB3    FGR
    FES    tec    EPHA10    SRC    FYN    MET

    EPHA5 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 5 variations for EPHA5
         4 CNVs: 63845 5216 98738 9481
         1 Indel: 46675
    Human Gene Mutation Database (HGMD): EPHA5
    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing EPHA5
    DNA2.0 Custom Variant and Variant Library Synthesis for EPHA5

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    EPHA5 for disorders           About GeneDecksing

    OMIM gene information: 600004    OMIM disorders: --

    9 diseases for EPHA5:    About MalaCards
    drug psychosis    pancreatic ductal adenocarcinoma    ovarian cancer    adenocarcinoma
    breast cancer    pancreatitis    glioblastoma    cerebritis
    neuronitis

    1 disease from the University of Copenhagen DISEASES database for EPHA5:
    Drug psychosis
    Human Genome Epidemiology (HuGE) Navigator: EPHA5 (1 document)

    Export disorders for EPHA5 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for EPHA5 gene, integrated from 9 sources (see all 44):
    (articles sorted by number of sources associating them with EPHA5)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PubMed id 9267020)1, 2, 3 (1997)
    2. Immunohistochemical localization of EphA5 in the adul t human central nervous system. (PubMed id 10375373)1, 2 Olivieri G. and Miescher G.C. (1999)
    3. Extensive splice variation and localization of the EHK-1 receptor tyrosine kinase in adult human brain and glial tumors. (PubMed id 9191074)1, 2 Miescher G.C....Steck A.J. (1997)
    4. cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases. (PubMed id 7898931)1, 2 Fox G.M.... Welcher A.A. (1995)
    5. A YAC contig spanning a cluster of human type III rec eptor protein tyrosine kinase genes (PDGFRA-KIT-KDR) in chromosome segment 4q12 . (PubMed id 7528718)1, 3 Spritz R.A....Moir D.T. (1994)
    6. Frequent epigenetic inactivation of the receptor tyro sine kinase EphA5 by promoter methylation in human breast cancer. (PubMed id 19733895)1, 9 Fu D.Y....Shao Z.M. (2010)
    7. Functional activation of EphA5 receptor does not promote cell proliferation in the aberrant EphA5 expressing human glioblastoma U-118 MG cell line. (PubMed id 10064801)1, 9 Bruce V....Miescher G.C. (1999)
    8. Regulation of topographic projection by the Eph family receptor Bsk (EphA5) and its ligands. (PubMed id 9321686)1, 9 Zhou R. (1997)
    9. MicroRNA-34a regulates migration of chondroblast and IL-1I^-induced degeneration of chondrocytes by targeting EphA5. (PubMed id 22079638)1 Kim D....Jin E.J. (2011)
    10. Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure. (PubMed id 22174851)1 Lingappa J.R....Goldstein D. (2011)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 2044 HGNC: 3389 AceView: EPHA5 Ensembl:ENSG00000145242 euGenes: HUgn2044
    ECgene: EPHA5 Kegg: 2044 H-InvDB: EPHA5

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for EPHA5 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for EPHA5 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for EPHA5 gene:
    Search GeneIP for patents involving EPHA5

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Small Molecules at EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
     EMD Millipore Purified and/or Recombinant EPHA5 Protein
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for EPHA5 (EphA5)   Browse Cell Culture Products  
     ELISAs for EPHA5 (EphA5)   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Multiplex/Array Assay Kits/Reagents for EPHA5 (EphA5)  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Recombinant/Natural Proteins for EPHA5 (EphA5)  
     Browse OriGene Antibodies   OriGene shRNA RFP for EPHA5  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA5   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA5  
     OriGene Protein Over-expression Lysate for EPHA5   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for EPHA5   OriGene 3'-UTR Clone for EPHA5  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA5  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for EPHA5   OriGene Custom Protein Services for EPHA5  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat EPHA5
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing EPHA5
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat EPHA5
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA5
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA5
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA5
     GenScript Custom Purified and Recombinant Proteins Services for EPHA5 GenScript cDNA clones with any tag delivered in your preferred vector for EPHA5
     GenScript EPHA5-Activity-based Kinase Assay for Compound Screening GenScript Custom Superior Antibodies Services for EPHA5
     GenScript Custom overexpressing Cell Line Services for EPHA5 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Antibodies & Assays for EPHA5 

     Regulatory tfbs in EPHA5 promoter
     Search Chromatin IP Primers for EPHA5
     RT2 qPCR Primer Assay in human, mouse, rat EPHA5
     Search GNC Networks for EPHA5
     SABiosciences PCR Arrays including human, mouse, rat EPHA5
     Search Tocris compounds for EPHA5
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     EPHA5 antibodies
     EPHA5 proteins
     Search for Antibodies for EPHA5 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for EPHA5
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     EPHA5 Proteins, Antibodies, CLIAs, and ELISAs
     Cell Line associated with EPHA5: PureStem E15, Meso-prx/latp Progenitor
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA5
     SwitchGear 3'UTR luciferase reporter plasmids for EPHA5
     SwitchGear Promoter luciferase reporter plasmids for EPHA5
     ThermoFisher Antibodies for EPHA5
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA5
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      EPHA5 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4