Free for academic non-profit institutions. Other users need a Commercial license

Aliases for EPHA5 Gene

Aliases for EPHA5 Gene

  • EPH Receptor A5 2 3 5
  • Brain-Specific Kinase 3 4
  • EPH Homology Kinase 1 3 4
  • EPH-Like Kinase 7 3 4
  • EC 2.7.10.1 4 61
  • TYRO4 3 4
  • EHK-1 3 4
  • EHK1 3 4
  • HEK7 3 4
  • EK7 3 4
  • Tyrosine-Protein Kinase Receptor EHK-1 3
  • Receptor Protein-Tyrosine Kinase HEK7 3
  • Ephrin Type-A Receptor 5 3
  • EC 2.7.10 61
  • EphA5 2
  • CEK7 3
  • BSK 4

External Ids for EPHA5 Gene

Previous GeneCards Identifiers for EPHA5 Gene

  • GC04U990011
  • GC04M066173
  • GC04M066193
  • GC04M066014
  • GC04M065872
  • GC04M062095

Summaries for EPHA5 Gene

Entrez Gene Summary for EPHA5 Gene

  • This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

GeneCards Summary for EPHA5 Gene

EPHA5 (EPH Receptor A5) is a Protein Coding gene. Diseases associated with EPHA5 include Acrodermatitis Chronica Atrophicans and Drug-Induced Mental Disorder. Among its related pathways are Activation of cAMP-Dependent PKA and EPHA forward signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is EPHA3.

UniProtKB/Swiss-Prot for EPHA5 Gene

  • Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).

Tocris Summary for EPHA5 Gene

  • Eph receptors are the largest family of receptor tyrosine kinases (RTKs) and are divided into two subclasses, EphA and EphB. Originally identified as mediators of axon guidance, Eph receptors are implicated in many processes, particularly cancer development and progression.

Gene Wiki entry for EPHA5 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EPHA5 Gene

Genomics for EPHA5 Gene

Regulatory Elements for EPHA5 Gene

Enhancers for EPHA5 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH04F065667 0.8 FANTOM5 ENCODE 12.8 +1.1 1146 3.7 CTCF CBX3 MAX ZNF76 ZIC2 ZFHX2 GLIS2 ZBTB48 ZNF366 POLR2A EPHA5 GC04M065667 EPHA5-AS1
GH04F066095 0.5 Ensembl 10.4 -423.9 -423906 0.4 EPHA5 LOC728048 GC04P066168
GH04F066123 0.5 VISTA 4.3 -453.7 -453711 0.9 EPHA5 LOC728048 GC04P066168
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around EPHA5 on UCSC Golden Path with GeneCards custom track

Promoters for EPHA5 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001431654 -5 1400 CTCF CBX3 ZNF76 ZIC2 ZFHX2 GLIS2 ZBTB48 ZNF366 POLR2A ZNF600
ENSR00001860015 995 201
ENSR00001860014 1395 201 EZH2

Genomic Location for EPHA5 Gene

Chromosome:
4
Start:
65,319,563 bp from pter
End:
65,670,495 bp from pter
Size:
350,933 bases
Orientation:
Minus strand

Genomic View for EPHA5 Gene

Genes around EPHA5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
EPHA5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for EPHA5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for EPHA5 Gene

Proteins for EPHA5 Gene

  • Protein details for EPHA5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P54756-EPHA5_HUMAN
    Recommended name:
    Ephrin type-A receptor 5
    Protein Accession:
    P54756
    Secondary Accessions:
    • Q7Z3F2

    Protein attributes for EPHA5 Gene

    Size:
    1037 amino acids
    Molecular mass:
    114803 Da
    Quaternary structure:
    • Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).

    Three dimensional structures from OCA and Proteopedia for EPHA5 Gene

    Alternative splice isoforms for EPHA5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for EPHA5 Gene

Selected DME Specific Peptides for EPHA5 Gene

P54756:
  • MKLNTEVR
  • QLVGMLRG
  • RDLAARN
  • GAGEFGEV
  • RWTAPEAI
  • DTGGRKD
  • RKFTSASD
  • LEDDPEAAYTT
  • AHTNYTFE
  • TTNQAAPS
  • SVRVYYKKCP
  • GYTEKQRRDFL
  • GMKYLSDM
  • SDVWSYGI
  • MIVTEYMENGSLD
  • DTIAADE
  • LDKLIRNP
  • ALVSVRV
  • CTRPPSAP
  • KAKQDPEEEKM
  • QETSYTI
  • EGEWLVPIGKC
  • RARTAAGYG
  • LEGVVTKS
  • QAVHEFAKE
  • NLVCKVSDFGLSR
  • KFTLRDCNS
  • WTCLLLCAALR
  • LAFQDVGAC
  • GFYLAFQD
  • PKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI
  • YVFQIRA
  • DGQFTVIQL
  • EEGYRLP
  • ISNVNETS
  • GRLKLPG
  • FSRRFEFET
  • EASIMGQF
  • NGVSDLS
  • EPDRPNG
  • FPDTITGADSSQLLEVSG
  • QLMLDCW
  • TYEDPNQAV
  • LMLDCWQK
  • DPHTYEDP
  • SYGERPYW
  • IMGQFDHPNII
  • LKLPGKR
  • DMGYVHRDLAARNIL

Post-translational modifications for EPHA5 Gene

  • Phosphorylated. Phosphorylation is stimulated by the ligand EFNA5. Dephosphorylation upon stimulation by glucose, inhibits EPHA5 forward signaling and results in insulin secretion (By similarity).
  • Glycosylation at Asn 264, Asn 299, Asn 369, Asn 423, Asn 436, and Asn 461
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for EPHA5 (EphA5)
  • Santa Cruz Biotechnology (SCBT) Antibodies for EPHA5

Domains & Families for EPHA5 Gene

Suggested Antigen Peptide Sequences for EPHA5 Gene

Graphical View of Domain Structure for InterPro Entry

P54756

UniProtKB/Swiss-Prot:

EPHA5_HUMAN :
  • Contains 1 Eph LBD (Eph ligand-binding) domain.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Domain:
  • Contains 1 Eph LBD (Eph ligand-binding) domain.
  • Contains 2 fibronectin type-III domains.
  • Contains 1 protein kinase domain.
  • Contains 1 SAM (sterile alpha motif) domain.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
genes like me logo Genes that share domains with EPHA5: view

Function for EPHA5 Gene

Molecular function for EPHA5 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot Function:
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 most probably constitutes the cognate/functional ligand for EPHA5. Functions as an axon guidance molecule during development and may be involved in the development of the retinotectal, entorhino-hippocampal and hippocamposeptal pathways. Together with EFNA5 plays also a role in synaptic plasticity in adult brain through regulation of synaptogenesis. In addition to its function in the nervous system, the interaction of EPHA5 with EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion (By similarity).

Enzyme Numbers (IUBMB) for EPHA5 Gene

Gene Ontology (GO) - Molecular Function for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity IEA --
GO:0004714 transmembrane receptor protein tyrosine kinase activity IEA --
GO:0005003 ephrin receptor activity IEA,ISS --
GO:0005004 GPI-linked ephrin receptor activity IEA,ISS --
genes like me logo Genes that share ontologies with EPHA5: view
genes like me logo Genes that share phenotypes with EPHA5: view

Animal Models for EPHA5 Gene

MGI Knock Outs for EPHA5:

Animal Model Products

Inhibitory RNA Products

Cell Line Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EPHA5 Gene

Localization for EPHA5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for EPHA5 Gene

Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for EPHA5 Gene COMPARTMENTS Subcellular localization image for EPHA5 gene
Compartment Confidence
endoplasmic reticulum 5
plasma membrane 5
nucleus 2
cytosol 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005791 rough endoplasmic reticulum IDA 10375373
GO:0005886 plasma membrane TAS --
GO:0005887 integral component of plasma membrane IEA --
GO:0005912 adherens junction IEA --
GO:0009897 external side of plasma membrane IDA 10064801
genes like me logo Genes that share ontologies with EPHA5: view

Pathways & Interactions for EPHA5 Gene

genes like me logo Genes that share pathways with EPHA5: view

SIGNOR curated interactions for EPHA5 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for EPHA5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IEA --
GO:0007399 nervous system development IEA --
GO:0007411 axon guidance IEA,ISS --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with EPHA5: view

Drugs & Compounds for EPHA5 Gene

(3) Drugs for EPHA5 Gene - From: PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 2758
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for EPHA5 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with EPHA5: view

Transcripts for EPHA5 Gene

Unigene Clusters for EPHA5 Gene

EPH receptor A5:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for EPHA5 Gene

No ASD Table

Relevant External Links for EPHA5 Gene

GeneLoc Exon Structure for
EPHA5
ECgene alternative splicing isoforms for
EPHA5

Expression for EPHA5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for EPHA5 Gene

mRNA differential expression in normal tissues according to GTEx for EPHA5 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x7.9), Brain - Hippocampus (x7.5), Brain - Anterior cingulate cortex (BA24) (x7.5), Brain - Amygdala (x5.7), and Brain - Cortex (x4.7).

Protein differential expression in normal tissues from HIPED for EPHA5 Gene

This gene is overexpressed in Fetal Brain (45.7) and Cerebrospinal fluid (19.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EPHA5 Gene



Protein tissue co-expression partners for EPHA5 Gene

NURSA nuclear receptor signaling pathways regulating expression of EPHA5 Gene:

EPHA5

SOURCE GeneReport for Unigene cluster for EPHA5 Gene:

Hs.654492

mRNA Expression by UniProt/SwissProt for EPHA5 Gene:

P54756-EPHA5_HUMAN
Tissue specificity: Almost exclusively expressed in the nervous system in cortical neurons, cerebellar Purkinje cells and pyramidal neurons within the cortex and hippocampus. Display an increasing gradient of expression from the forebrain to hindbrain and spinal cord.
genes like me logo Genes that share expression patterns with EPHA5: view

Primer Products

Orthologs for EPHA5 Gene

This gene was present in the common ancestor of chordates.

Orthologs for EPHA5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia EPHA5 34 35
  • 99.58 (n)
cow
(Bos Taurus)
Mammalia EPHA5 35
  • 98 (a)
OneToOne
LOC100337226 34
  • 94.5 (n)
dog
(Canis familiaris)
Mammalia EPHA5 34 35
  • 95.32 (n)
oppossum
(Monodelphis domestica)
Mammalia EPHA5 35
  • 95 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia EPHA5 35
  • 95 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Epha5 34
  • 91.1 (n)
mouse
(Mus musculus)
Mammalia Epha5 34 16 35
  • 90.39 (n)
chicken
(Gallus gallus)
Aves EPHA5 34 35
  • 83.9 (n)
lizard
(Anolis carolinensis)
Reptilia EPHA5 35
  • 93 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia epha5 34
  • 78.14 (n)
zebrafish
(Danio rerio)
Actinopterygii CT990561.1 35
  • 79 (a)
OneToOne
LOC797595 34
  • 72.52 (n)
Species where no ortholog for EPHA5 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for EPHA5 Gene

ENSEMBL:
Gene Tree for EPHA5 (if available)
TreeFam:
Gene Tree for EPHA5 (if available)

Paralogs for EPHA5 Gene

Variants for EPHA5 Gene

Sequence variations from dbSNP and Humsavar for EPHA5 Gene

SNP ID Clin Chr 04 pos Sequence Context AA Info Type
rs199614818 A lung adenocarcinoma sample 65,490,529(+) TTTGC(A/C/T)GGGGA intron-variant, reference, missense
VAR_042142 A lung large cell carcinoma sample
VAR_042143 A lung adenocarcinoma sample
VAR_042146 A lung squamous cell carcinoma sample
VAR_042148 A lung large cell carcinoma sample

Structural Variations from Database of Genomic Variants (DGV) for EPHA5 Gene

Variant ID Type Subtype PubMed ID
dgv2816n106 CNV deletion 24896259
esv1746107 CNV insertion 17803354
esv2021289 CNV deletion 18987734
esv2294940 CNV deletion 18987734
esv2422517 CNV duplication 17116639
esv24754 CNV loss 19812545
esv2501169 CNV deletion 19546169
esv2671686 CNV deletion 23128226
esv2676800 CNV deletion 23128226
esv2727747 CNV deletion 23290073
esv2727748 CNV deletion 23290073
esv2727749 CNV deletion 23290073
esv3383960 CNV insertion 20981092
esv3400337 CNV insertion 20981092
esv3600795 CNV loss 21293372
esv988089 CNV insertion 20482838
esv993892 CNV insertion 20482838
nsv1014463 CNV gain 25217958
nsv1114538 CNV deletion 24896259
nsv1149744 CNV deletion 26484159
nsv290967 CNV deletion 16902084
nsv291171 CNV insertion 16902084
nsv291266 CNV insertion 16902084
nsv470041 CNV loss 18288195
nsv475367 CNV novel sequence insertion 20440878
nsv507172 OTHER sequence alteration 20534489
nsv509905 OTHER sequence alteration 20534489
nsv818239 CNV gain 17921354
nsv980208 CNV duplication 23825009

Variation tolerance for EPHA5 Gene

Residual Variation Intolerance Score: 6.57% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.77; 66.62% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for EPHA5 Gene

Human Gene Mutation Database (HGMD)
EPHA5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
EPHA5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EPHA5 Gene

Disorders for EPHA5 Gene

MalaCards: The human disease database

(5) MalaCards diseases for EPHA5 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
acrodermatitis chronica atrophicans
  • herxheimer disease
drug psychosis
  • drug-induced psychosis
drug-induced mental disorder
lung large cell carcinoma
  • large cell carcinoma of lung
primary bacterial infectious disease
- elite association - COSMIC cancer census association via MalaCards
Search EPHA5 in MalaCards View complete list of genes associated with diseases

Relevant External Links for EPHA5

Genetic Association Database (GAD)
EPHA5
Human Genome Epidemiology (HuGE) Navigator
EPHA5
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
EPHA5
genes like me logo Genes that share disorders with EPHA5: view

No data available for UniProtKB/Swiss-Prot and Genatlas for EPHA5 Gene

Publications for EPHA5 Gene

  1. Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PMID: 9267020) (Cell 1997) 2 3 4 64
  2. Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure. (PMID: 22174851) Lingappa J.R. … Goldstein D. (PLoS ONE 2011) 3 46 64
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  4. Frequent epigenetic inactivation of the receptor tyrosine kinase EphA5 by promoter methylation in human breast cancer. (PMID: 19733895) Fu D.Y. … Shao Z.M. (Hum. Pathol. 2010) 3 22 64
  5. Immunohistochemical localization of EphA5 in the adult human central nervous system. (PMID: 10375373) Olivieri G. … Miescher G.C. (J. Histochem. Cytochem. 1999) 3 4 64

Products for EPHA5 Gene

Sources for EPHA5 Gene

Content
Loading form....