Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

EPHA3 Gene

protein-coding   GIFtS: 67
GCID: GC03P089239

EPH receptor A3

(Previous name: EphA3 )
(Previous symbols: ETK, ETK1, TYRO4)
 Explore 51 diseases affiliated with
EPHA3 via our new
 Human Malady Compendium 
Biological research products
for EPHA3
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
EPH Receptor A31 2     EC 2.7.10.13 8
ETK11 2 3 5     EphA31
HEK1 2 3 5     Ephrin Type-A Receptor 32
ETK1 2 3     Human Embryo Kinase 12
TYRO41 2 3     TYRO4 Protein Tyrosine Kinase2
HEK41 2     HEK41 2
Eph-Like Tyrosine Kinase 12 3     Human Embryo Kinase3
Tyrosine-Protein Kinase Receptor ETK12 3     Tyrosine-Protein Kinase TYRO43
EK42 3     EC 2.7.108
EPH-Like Kinase 42 3     

External Ids:    HGNC: 33871   Entrez Gene: 20422   Ensembl: ENSG000000445247   OMIM: 1796115   UniProtKB: P293203   

Export aliases for EPHA3 gene to outside databases

Previous GC identifers: GC03P089525 GC03P092010 GC03P089036 GC03P089077


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for EPHA3:
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors
have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH
subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2
fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their
extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a
protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene.
(provided by RefSeq, Jul 2008)

UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320
Function: Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent
cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream
of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is
referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon
activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in
cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum
during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also
control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development

Gene Wiki entry for EPHA3 (EPH receptor A3)


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000003.11  NC_018914.1  NT_022459.15  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the EPHA3 gene promoter:
         AP-1   HTF   ATF-2   IRF-7A   STAT3   c-Jun   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidEPHA3 promoter sequence
   Search SABiosciences Chromatin IP Primers for EPHA3

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat EPHA3


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 3p11.2   Ensembl cytogenetic band:  3p11.1   HGNC cytogenetic band: 3p11.2

EPHA3 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
EPHA3 gene location

GeneLoc information about chromosome 3         GeneLoc Exon Structure

GeneLoc location for GC03P089239:  view genomic region     (about GC identifiers)

Start:
89,156,674 bp from pter      End:
89,531,284 bp from pter
Size:
374,611 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320 (See protein sequence)
Recommended Name: Ephrin type-A receptor 3 precursor  
Size: 983 amino acids; 110131 Da
Subunit: Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor
dimer. Oligomerization is probably required to induce biological responses. Forms a ternary EFNA5-EPHA3-ADAM10 complex
mediating EFNA5 extracellular domain shedding by ADAM10 which regulates the EFNA5-EPHA3 complex internalization and
function. Interacts with NCK1 (via SH2 domain); mediates EFNA5-EPHA3 signaling (By similarity). Interacts
(phosphorylated) with PTPN1; dephosphorylates EPHA3 and may regulate its trafficking and function. Interacts
(phosphorylated) with CRK; mediates EFNA5-EPHA3 signaling through RHOA GTPase activation
Subcellular location: Isoform 1: Cell membrane; Single-pass type I membrane protein
Subcellular location: Isoform 2: Secreted
6/21 PDB 3D structures from and Proteopedia for EPHA3 (see all 21):
2GSF (3D)        2QO2 (3D)        2QO7 (3D)        2QO9 (3D)        2QOB (3D)        2QOC (3D)    
Secondary accessions: Q9H2V3 Q9H2V4
Alternative splicing: 2 isoforms:  P29320-1   P29320-2   

Explore the universe of human proteins at neXtProt for EPHA3: NX_P29320

Post-translational modifications:

  • Autophosphorylates upon activation by EFNA5. Phosphorylation on Tyr-602 mediates interaction with NCK1.
  • Dephosphorylated by PTPN11
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P29320

  • 62 DME Specific Peptides for EPHA3 (P29320) (see first 4)
     MSNQDVI  RDLAARN  QNNWLRT  RWTSPEA 
     DTGGRKD  CKETFNL  KKCPFTV  YVFQIRA 
     FEFETSP  AQKIYVE  DTIAADE  LAMFPDT 
     ALVSVRV  TYQVCNV  FAKELDA  GWEEISG 
     QETSYTI  QLMLDCW  NWLRTNW  SLVEVRG 
     AAVSITT  LDYEVKY  KDRTSRNS  QLVGMLRG 
     RPKFEQIV  GAGEFGEV  RKFTSASD  CNAGYEER 
     TTNQAAPS  AHTNYTFE  NIIRLEGV  GFYLAFQD 
     YEVKYYEK  GMKYLSDM  EASIMGQF  SDVWSYGI 
     NVRFLPRQ  LDKLIRNP  LMLDCWQK  SYGERPYW 
     DPHTYEDP  LEGVVTKS  SGMKYLSDM  KFTLRDCNS 
     GLTNTTVTV  LAFQDVGAC  PNGIILDYE  RARTAAGYG 
     QAVHEFAKE  ACRPGFYKA  YRLPPPMDCP  WEVMSYGERPY 
     LSWQEPEHPNG  LEDDPEAAYTT  GYTEKQRRDFL  EGEWLVPIGKC 
     IMGQFDHPNII  NLVCKVSDFGLSR  MIVTEYMENGSLD  AAARPSNLLLDQSN 
     DMGYVHRDLAARNIL  IFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKI 

    EPHA3 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (2 alternative transcripts): 
    NP_005224.2  NP_872585.1  

    ENSEMBL proteins: 
     ENSP00000337451   ENSP00000399926   ENSP00000419190  

    Human Recombinant Protein Products: 
    EMD Millipore Purified and/or Recombinant EPHA3 Protein
    R&D Systems Recombinant & Natural Proteins for EPHA3
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein: EPHA3
    OriGene Protein Over-expression Lysate: EPHA3
    OriGene Custom Protein Services for EPHA3 
    GenScript Purified and Recombinant Proteins for EPHA3
    Novus Biologicals EPHA3 Proteins
    Novus Biologicals EPHA3 Lysates
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for EPHA3

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005576extracellular region IEA--
    GO:0005769early endosome IDA--
    GO:0005887integral to plasma membrane IDA11870224


    EPHA3 for ontologies           About GeneDecksing



    EPHA3 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    R&D Systems Antibodies for EPHA3
    Cell Signaling Technology (CST) Antibodies for EPHA3 
    OriGene Antibodies (see all 2): EPHA3
    OriGene Custom Antibody Services for EPHA3 
    GenScript Custom Superior Antibodies Services for EPHA3
    Novus Biologicals EPHA3 Antibodies
    Abcam antibodies for EPHA3 
    Uscn Antibodies for EPHA3
    ThermoFisher Antibodies for EPHA3

    Assay Products for EPHA3: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    R&D Systems Multiplex/Array Assay Kits & Reagents for EPHA3
    GenScript EPHA3-Activity-based Kinase Assay for Compound Screening
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for EPHA3


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    EPHA3 for domains           About GeneDecksing

    5/16 InterPro domains/families (see all 16):
     IPR011641 Tyr-kin_ephrin_A/B_rcpt-like
     IPR017441 Protein_kinase_ATP_BS
     IPR013761 SAM/pointed
     IPR001660 SAM
     IPR011510 SAM_2

    Graphical View of Domain Structure for InterPro Entry P29320

    ProtoNet protein and cluster: P29320

    5/6 Blocks protein families (see all 6):
    IPB001090 Ephrin receptor
    IPB001426 Receptor tyrosine kinase
    IPB001660 Sterile alpha motif SAM
    IPB003962 Fibronectin type III repeat signature
    IPB008266 Tyrosine protein kinase


    UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320
    Similarity: Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily
    Similarity: Contains 1 Eph LBD (Eph ligand-binding) domain
    Similarity: Contains 2 fibronectin type-III domains
    Similarity: Contains 1 protein kinase domain
    Similarity: Contains 1 SAM (sterile alpha motif) domain


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320
    Function: Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent
    cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream
    of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is
    referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon
    activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in
    cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum
    during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also
    control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development
    Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate

         Genatlas biochemistry entry for EPHA3:
    EPH-related tyrosine kinase receptor binding ephrins A,expressed in projecting neurons and their target fields,involved
    in short-range contact-mediated axonal guidance,expressed by some pre-B and T cell lines,not detectable on normal
    adult human tissues

    Enzyme Numbers (IUBMB): EC 2.7.10.11 2 EC 2.7.102

    miRNA
    Products:
        
    OriGene 3'-UTR Clone (see all 2): EPHA3
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat EPHA3
    8/80 QIAGEN miScript miRNA Assays for microRNAs that regulate EPHA3 (see all 80):
    hsa-miR-411* hsa-miR-323-3p hsa-miR-548j hsa-miR-3607-3p hsa-miR-3653 hsa-miR-550a* hsa-miR-208b hsa-miR-508-5p
    SwitchGear 3'UTR luciferase reporter plasmidEPHA3 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA3 (see all 7)
    OriGene shRNA RFP: EPHA3
    OriGene siRNA: EPHA3
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA3

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for EPHA3

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3 (see all 6)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): EPHA3 (NM_005233)
    Sino Biological Human cDNA Clone for EPHA3
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for EPHA3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA3 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for EPHA3
    Search LifeMap BioReagents cell lines for EPHA3

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA3

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005003ephrin receptor activity ----
    GO:0005004GPI-linked ephrin receptor activity IDA11870224
    GO:0005515protein binding IPI--
    GO:0005524ATP binding IEA--


    EPHA3 for ontologies           About GeneDecksing


    1 GenomeRNAi human phenotype for EPHA3:
     Decreased substrate adherent c 

    Animal Models:
         Mouse knock-out Epha3tm1Abn for EPHA3
         6 MGI mutant phenotypes (inferred from 1 allele(MGI details for Epha3):
     behavior/neurological  cardiovascular system  homeostasis/metabolism  liver/biliary system  mortality/aging 
     respiratory system 

    EPHA3 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/19 super-pathways (see all 19About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1GPCR Pathway
    GPCR Pathway1.00
    Estrogen Pathway0.55
    Ras Pathway0.62
    Pancreatic Adenocarcinoma0.55
    Breast Cancer Regulation by Stathmin10.58
    Paxillin Interactions0.53
    NFAT in Immune Response0.58
    P2Y Receptor Signaling0.38
    2Rho Family GTPases
    Rho Family GTPases1.00
    MAPK Signaling0.51
    ERK Signaling0.61
    ILK Signaling0.45
    Molecular Mechanisms of Cancer0.51
    3Nanog in Mammalian ESC Pluripotency
    Nanog in Mammalian ESC Pluripotency1.00
    14-3-3 Induced Intracellular Signaling0.59
    GSK3 Signaling0.61
    eNOS Signaling0.48
    4Actin Nucleation by ARP-WASP Complex
    Actin Nucleation by ARP-WASP Complex1.00
    CDC42 Pathway0.34
    Actin Nucleation and Branching0.66
    5G-protein signaling_RhoA regulation pathway
    G-protein signaling_RhoA regulation pathway1.00
    EphrinA-EphR Signaling0.26
    G-protein signaling RhoA regulation pathway1.00

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    3 EMD Millipore Pathways for EPHA3
        Neurophysiological process Receptor-mediated axon growth repulsion
    Cell adhesion Ephrins signaling
    G-protein signaling RhoA regulation pathway

    5/32 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for EPHA3 (see all 32)
        Paxillin Interactions
    Molecular Mechanisms of Cancer
    Intracellular Calcium Signaling
    JNK Pathway
    P2Y Receptor Signaling

    1 Cell Signaling Technology (CST) Pathway for EPHA3
        Tyrosine Kinases / Adaptors

    3 GeneGo (Thomson Reuters) Pathways for EPHA3
        Neurophysiological process Receptor-mediated axon growth repulsion
    G-protein signaling RhoA regulation pathway
    Cell adhesion Ephrins signaling

    2 BioSystems Pathways for EPHA3 
        EPHA forward signaling
    EphrinA-EPHA pathway


    1         Kegg Pathway  (Kegg details for EPHA3):
        Axon guidance


    EPHA3 for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for EPHA3

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/37 Interacting proteins for EPHA3 (P293202, 3 ENSP000003374514) via UniProtKB, MINT, STRING, and/or I2D (see all 37)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    RUFY1Q96T512, 3, ENSP000003770944MINT-8032251 MINT-8035980 I2D: score=2 STRING: ENSP00000377094
    CDKN2AP427713, ENSP000003551534I2D: score=1 I2D: score=1 STRING: ENSP00000355153
    CRKP461083, ENSP000003005744I2D: score=2 STRING: ENSP00000300574
    EFNA1P208273, ENSP000003573924I2D: score=2 STRING: ENSP00000357392
    EFNA5P528033, ENSP000003287774I2D: score=2 STRING: ENSP00000328777
    About this table

    Gene Ontology (GO): 5/16 biological process terms (GO ID links to tree view) (see all 16):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0001660fever generation ----
    GO:0006915apoptotic process ISS--
    GO:0007155cell adhesion IEA--
    GO:0010717regulation of epithelial to mesenchymal transition ISS--
    GO:0010976positive regulation of neuron projection development IMP17910947


    EPHA3 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    EPHA3 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for EPHA3

    2 HMDB Compounds for EPHA3    About this table
    CompoundSynonyms CAS #PubMed Ids
    ADPadenosindiphosphorsaeure (see all 8)58-64-0--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    10/48 Novoseek chemical compound relationships for EPHA3 gene (see all 48)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    tab-1 73.8 4 11745395 (1), 17052891 (1), 17932218 (1), 19531477 (1)
    threonine 65.1 24 16641196 (1), 19966577 (1), 20416281 (1), 9405407 (1) (see all 23)
    pd 98,059 59.7 10 18778461 (1), 10925306 (1), 12628005 (1), 14690534 (1) (see all 9)
    tyrosine 57.3 21 1334998 (2), 8188238 (2), 15151996 (1), 18762249 (1) (see all 18)
    serine 55 22 16641196 (1), 19966577 (1), 20416281 (1), 9405407 (1) (see all 22)
    cl 100 52.7 1 15030167 (1)
    sb 203580 50.5 2 18778461 (1), 12589827 (1)
    phosphatidylinositol 48.8 5 14633175 (1), 16322251 (1), 11382770 (1), 12589827 (1) (see all 5)
    phosphoinositide 46.6 8 15468165 (1), 16885398 (1), 16895519 (1), 19920184 (1) (see all 8)
    sp 600125 38.5 3 18778461 (1), 15670787 (1), 12589827 (1)

    Search CenterWatch for drugs/clinical trials and news about EPHA3 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for EPHA3 gene (2 alternative transcripts): 
    NM_005233.5  NM_182644.2  

    Unigene Cluster for EPHA3:

    EPH receptor A3
    Hs.123642  [show with all ESTs]
    Unigene Representative Sequence: NM_005233
    3 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000336596(uc021xbf.1 uc003dqy.3) ENST00000452448(uc003dqx.1)
    ENST00000494014

    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 2): EPHA3
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat EPHA3
    8/80 QIAGEN miScript miRNA Assays for microRNAs that regulate EPHA3 (see all 80):
    hsa-miR-411* hsa-miR-323-3p hsa-miR-548j hsa-miR-3607-3p hsa-miR-3653 hsa-miR-550a* hsa-miR-208b hsa-miR-508-5p
    SwitchGear 3'UTR luciferase reporter plasmidEPHA3 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA3 (see all 7)
    OriGene shRNA RFP: EPHA3
    OriGene siRNA: EPHA3
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA3
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3 (see all 6)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): EPHA3 (NM_005233)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for EPHA3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA3 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA3
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat EPHA3
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA3
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA3

    Additional cDNA sequence: 

    AF213459.1 AF213460.1 AK024352.1 AK291411.1 BC026247.1 BC063282.1 HM437236.1 M83941.1 

    4 DOTS entries:

    DT.97837000  DT.208723  DT.40125530  DT.100662313 

    24/45 AceView cDNA sequences (see all 45):

    BC063282 AI741389 AL042479 AF213459 NM_182644 AF213460 T28603 BC026247 
    AU120483 AU137594 NM_005233 AK024352 AI918950 BE327884 AI824661 BF194844 
    D81814 M85652 BQ003325 AI590014 BG572424 BX441974 AU136712 BG033947 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    EPHA3 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: --

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    EPHA3 expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    9 LifeMap In Vivo Development Anatomical Compartments/Cells 
    Tissue Anatomical Compartment CellCategory (developmental path)
    BoneZeugopod Epiphyseal EndChondrocytesBone, Cartilage
    EyeInner Nuclear LayerType1 Off Cone Bipolar CellsBipolar, Retina
    HeartEndocardiumCushion Mesenchymal CellsEndocardium
    BrainHypothalamusBrain
    BrainThalamusBrain
    KidneyInterstitial StromaKidney
    Neural TubeDiencephalic Ventricular ZoneNeural Tube
    Neural TubeDiencephalonNeural Tube
    Neural TubeTelencephalonNeural Tube
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization
    Stem Cell Differentiation: 1 LifeMap Cell 
    NameCategory
    Beating cell clusters (Spontaneous differen...)

    See EPHA3 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for EPHA3

    SOURCE GeneReport for Unigene cluster: Hs.123642

    UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320
    Tissue specificity: Widely expressed. Highest level in placenta

        SABiosciences Custom PCR Arrays for EPHA3
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA3
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat EPHA3
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA3
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA3
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA3

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for EPHA3 gene from 5/22 species (see all 22)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves EPHA31 EPH receptor A3 81.98(n)
    91.9(a)
      396402  NM_205430.1  NP_990761.1 
    lizard
    (Anolis carolinensis)
    Reptilia EPHA36
    --
    88(a)
    1 ↔ 1
    3(166700230-166879358)
    zebrafish
    (Danio rerio)
    Actinopterygii epha3l6
    CABZ01084877.16
    (see all 3)
    --
    83(a)
    31(a)
    (see all 3)
    1 ↔ 1
    possible ortholog
    (see all 3)
    9(16828231-16919914)
    Zv9_NA779(312-23840)
    fruit fly
    (Drosophila melanogaster)
    Insecta Eph3 protein amino acid phosphorylation
    transmembrane more
    40(a)
    (best of 2)
      102C2   --
    worm
    (Caenorhabditis elegans)
    Secernentea W04G5.103   -- 35(a)
    (best of 3)
      I(11646625-11648468)   --


    ENSEMBL Gene Tree for EPHA3 (if available)
    TreeFam Gene Tree for EPHA3 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for EPHA3 gene
    EPHB12  EPHA22  EPHB32  EPHA42  EPHA52  EPHB62  EPHA62  EPHB22  
    EPHA12  EPHA82  EPHA72  EPHB42  EPHA102  
    18/47 SIMAP similar genes for EPHA3 using alignment to 4 protein entries:     EPHA3_HUMAN (see all proteins) (see all similar genes):
    EPHA6    EPHA4    EPHA7    EPHA5    EPHB1    EPHB2 variant protein
    EPHA8    EPHB2    EPHB3    EPHA2    ABL1    FGR
    EPHA10    FES    FYN    EPHB4    SRC    HCK

    EPHA3 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/5884 NCBI SNPs in EPHA3 are shown (see all 5884    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 3 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1419673451,2
    --89154699(+) TTACTA/GGTGAA 2 -- us2k10--------
    rs1506913991,2
    --89154859(+) AATGGC/TGCCTA 2 -- us2k10--------
    rs1437579921,2
    C,--89154934(+) TTCTA-/TTTTCA 2 -- us2k10--------
    rs1464826261,2
    C,--89155103(+) TCTCC-/AAAAAT 2 -- us2k10--------
    rs344192771,2
    C--89155104(+) CAAAA-/ATGTTT 2 -- us2k10--------
    rs1401813551,2
    --89155124(+) TGTCAA/GTTCCA 2 -- us2k10--------
    rs1868942751,2
    --89155164(+) GAAAAC/TGTGTA 2 -- us2k10--------
    rs1419131351,2
    --89155169(+) CGTGTA/CTCTAA 2 -- us2k10--------
    rs1155196181,2
    F,--89155299(+) ATTGCG/ACAGCC 2 -- us2k11Minor allele frequency- A:0.03WA 118
    rs1463061191,2
    --89155304(+) GCAGCC/TTCTGG 2 -- us2k10--------

    HapMap Linkage Disequilibrium report for EPHA3 (89156674 - 89406674 bp, first 250kb of EPHA3)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 15 variations for EPHA3
         15 CNVs: 1627 51187 1373 51188 32501 98373 7420 36170 53182 63520 51189 2464 23175 38507 51186
    Human Gene Mutation Database (HGMD): EPHA3

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing EPHA3
    DNA2.0 Custom Variant and Variant Library Synthesis for EPHA3

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    EPHA3 for disorders           About GeneDecksing

    OMIM gene information: 179611    OMIM disorders: --

    UniProtKB/Swiss-Prot: EPHA3_HUMAN, P29320
  • Defects in EPHA3 may be a cause of colorectal cancer (CRC) [MIM:114500]

  • 20/51 diseases for EPHA3 (see all 51):    About MalaCards
    spinal cord injury    pseudohypoaldosteronism type i    ampulla of vater carcinoma    proliferative vitreoretinopathy
    pseudohypoaldosteronism    pleomorphic rhabdomyosarcoma    vitreoretinopathy    neurodegenerative disease
    hepatitis c    acute myeloid leukemia    myeloid leukemia    familial colorectal cancer
    parkinson's disease    renal cell carcinoma    squamous cell carcinoma    rhabdomyosarcoma
    prostate cancer    neurodegeneration    prostate cancer, progression of    carcinoma

    10/25 Novoseek disease relationships for EPHA3 gene (see all 25)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    parkinson disease 51 17 16672981 (1), 17579517 (1), 19703660 (1), 17000703 (1) (see all 16)
    parkinsonism 37.2 10 16226715 (1), 19279012 (1), 17084972 (1), 17620882 (1) (see all 10)
    breast cancer 36.5 15 12151336 (2), 18392133 (2), 16322251 (1), 18650427 (1) (see all 13)
    neurodegeneration 33.3 2 19780893 (1), 20012177 (1)
    neurodegenerative diseases 31.3 1 18334630 (1)
    tumors 30.4 23 10498621 (2), 10987298 (2), 15688034 (1), 16778166 (1) (see all 20)
    cancer 27 8 14760089 (1), 17611497 (1), 12560069 (1), 14530270 (1) (see all 8)
    cardiac hypertrophy 11 1 18054038 (1)
    uveal melanoma 7.57 1 16845324 (1)
    necrosis 6.62 3 15523691 (1), 19298660 (1), 12889600 (1)

    Human Genome Epidemiology (HuGE) Navigator: EPHA3 (5 documents)

    Export disorders for EPHA3 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for EPHA3 gene, integrated from 9 sources (see all 474):
    (articles sorted by number of sources associating them with EPHA3)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Molecular cloning of HEK, the gene encoding a receptor tyrosine kinase expressed by human lymphoid tumor cell lines. (PubMed id 1311845)1, 2, 3 Wicks I.P....Boyd A.W. (1992)
    2. Isolation and characterization of a novel receptor-type protein tyrosine kinase (hek) from a human pre-B cell line. (PubMed id 1737782)1, 2, 3 Boyd A.W.... Busmanis I. (1992)
    3. Identification of a tumor-specific shared antigen derived from an Eph receptor and presented to CD4 T cells on HLA class II molecules. (PubMed id 10987298)1, 2, 9 Chiari R....Coulie P.G. (2000)
    4. Autoregulation by the juxtamembrane region of the human ephrin receptor tyrosine kinase A3 (EphA3). (PubMed id 18547520)1, 2, 9 Davis T.L....Dhe-Paganon S. (2008)
    5. Mutational profiling of kinases in human tumours of pancreatic origin identifies candidate cancer genes in ductal and ampulla of vater carcinomas. (PubMed id 20838624)1, 2 Corbo V....Scarpa A. (2010)
    6. Somatic mutations of GUCY2F, EPHA3, and NTRK3 in human cancers. (PubMed id 16941478)1, 2 Wood L.D....Velculescu V.E. (2006)
    7. Adam meets Eph: an ADAM substrate recognition module acts as a molecular switch for ephrin cleavage in trans. (PubMed id 16239146)1, 2 Janes P.W....Nikolov D.B. (2005)
    8. Ephrin-A5 induces rounding, blebbing and de-adhesion of EphA3-expressing 293T and melanoma cells by CrkII and Rho-mediated signalling. (PubMed id 11870224)1, 2 Lawrenson I.D....Lackmann M. (2002)
    9. Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. (PubMed id 9267020)1, 2 (1997)
    10. Low frequency mutation of the Ephrin receptor A3 gene in hepatocellular carcinoma. (PubMed id 19469653)1, 9 Bae H.J....Nam S.W. (2009)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 2042 HGNC: 3387 AceView: EPHA3 Ensembl:ENSG00000044524 euGenes: HUgn2042
    ECgene: EPHA3 Kegg: 2042 H-InvDB: EPHA3

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for EPHA3 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for EPHA3 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for EPHA3 gene:
    Search GeneIP for patents involving EPHA3

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     EMD Millipore Purified and/or Recombinant EPHA3 Protein
     Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Small Molecules at EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for EPHA3 (EphA3)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Multiplex/Array Assay Kits/Reagents for EPHA3 (EphA3)  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Recombinant/Natural Proteins for EPHA3 (EphA3)  
     OriGene Antibodies for EPHA3   OriGene shRNA RFP for EPHA3  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for EPHA3   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for EPHA3  
     OriGene Protein Over-expression Lysate for EPHA3   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for EPHA3   OriGene 3'-UTR Clone for EPHA3  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for EPHA3  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for EPHA3   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for EPHA3   OriGene Custom Protein Services for EPHA3  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat EPHA3
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing EPHA3
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat EPHA3
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat EPHA3
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat EPHA3
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat EPHA3
     GenScript Purified and Recombinant Proteins for EPHA3 GenScript cDNA clones with any tag delivered in your preferred vector for EPHA3
     GenScript EPHA3-Activity-based Kinase Assay for Compound Screening GenScript Custom Superior Antibodies Services for EPHA3
     GenScript Custom overexpressing Cell Line Services for EPHA3 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Antibodies & Assays for EPHA3 

     Regulatory tfbs in EPHA3 promoter
     Search Chromatin IP Primers for EPHA3
     RT2 qPCR Primer Assay in human, mouse, rat EPHA3
     GNC Network for EPHA3
     SABiosciences PCR Arrays including human, mouse, rat EPHA3
     Search Tocris compounds for EPHA3
     Browse Sino Biological Proteins and Antibodies
     cDNA Clones for EPHA3
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     EPHA3 antibodies
     EPHA3 proteins
     EPHA3 lysates
     Antibodies for EPHA3
     See all of Abcam's Antibodies, Kits and Proteins for EPHA3
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     EPHA3 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for EPHA3
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for EPHA3
     SwitchGear 3'UTR luciferase reporter plasmids for EPHA3
     SwitchGear Promoter luciferase reporter plasmids for EPHA3
     ThermoFisher Antibodies for EPHA3
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat EPHA3
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      EPHA3 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4