Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ENPP2 Gene

Aliases for ENPP2 Gene

  • Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 2 3 5
  • Autotaxin 2 3 4
  • Extracellular Lysophospholipase D 3 4
  • EC 3.1.4.39 4 61
  • E-NPP 2 3 4
  • LysoPLD 3 4
  • PDNP2 3 4
  • ATX 3 4
  • Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 2 3
  • Phosphodiesterase I/Nucleotide Pyrophosphatase 2 3
  • Plasma Lysophospholipase D 3
  • Autotaxin-T 3
  • PD-IALPHA 3
  • ATX-X 3
  • NPP2 3

External Ids for ENPP2 Gene

Previous HGNC Symbols for ENPP2 Gene

  • PDNP2

Previous GeneCards Identifiers for ENPP2 Gene

  • GC08M120575
  • GC08M120238
  • GC08M120525
  • GC08M120638
  • GC08M115890
  • GC08M120569

Summaries for ENPP2 Gene

Entrez Gene Summary for ENPP2 Gene

  • The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2008]

GeneCards Summary for ENPP2 Gene

ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) is a Protein Coding gene. Diseases associated with ENPP2 include Teratocarcinoma and Intrahepatic Cholestasis. Among its related pathways are Metabolism of water-soluble vitamins and cofactors and phospholipases. GO annotations related to this gene include nucleic acid binding and hydrolase activity. An important paralog of this gene is ENPP1.

UniProtKB/Swiss-Prot for ENPP2 Gene

  • Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor.

Tocris Summary for ENPP2 Gene

  • Autotaxin (also known as nucleotide pyrophosphatase-phosphodiesterase 2, NPP2) is a secreted enzyme with lysophospholipase D activity and is the primary enzyme responsible for generating lysophosphatidic acid (LPA).

Gene Wiki entry for ENPP2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ENPP2 Gene

Genomics for ENPP2 Gene

Regulatory Elements for ENPP2 Gene

Enhancers for ENPP2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH08G119697 0.9 dbSUPER 15.7 -24.9 -24935 2.3 FOXA2 ATF1 MLX ZFP64 ARID4B DMAP1 GATA2 FOS MXD4 MIER2 ENPP2 DSCC1 RN7SKP153
GH08G119721 1.2 ENCODE dbSUPER 11.6 -48.7 -48723 1.6 ELF3 PKNOX1 FOXA2 FEZF1 RAD21 RARA YY1 GATA4 GATA2 ZNF366 ENPP2 TAF2 DSCC1 RN7SKP153
GH08G119638 1.1 ENCODE dbSUPER 11.9 +34.2 34185 1.7 TBP WRNIP1 SIN3A BMI1 RAD21 RFX5 YY1 SCRT2 RELB IKZF2 ENPP2 CYCSP23 LOC105375727
GH08G119635 0.8 dbSUPER 15.9 +37.4 37443 1.4 SOX13 MXI1 FOXA2 RARA YY1 TEAD3 NCOR1 HNF4G HOMEZ MIXL1 ENPP2 DSCC1 CYCSP23 LOC105375727
GH08G119553 1 Ensembl ENCODE dbSUPER 10.7 +119.9 119898 0.3 CTCF HLF CEBPB NFE2L2 ENPP2 CYCSP23 LOC392264
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ENPP2 on UCSC Golden Path with GeneCards custom track

Promoters for ENPP2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000229437 253 401 SOX13 FOXA2 RBBP5 ZNF48 YY1 POLR2A HNRNPL EZH2

Genomic Location for ENPP2 Gene

Chromosome:
8
Start:
119,557,077 bp from pter
End:
119,673,453 bp from pter
Size:
116,377 bases
Orientation:
Minus strand

Genomic View for ENPP2 Gene

Genes around ENPP2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ENPP2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ENPP2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ENPP2 Gene

Proteins for ENPP2 Gene

  • Protein details for ENPP2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13822-ENPP2_HUMAN
    Recommended name:
    Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
    Protein Accession:
    Q13822
    Secondary Accessions:
    • A8UHA1
    • E9PHP7
    • Q13827
    • Q14555
    • Q15117
    • Q9UCQ8
    • Q9UCR0
    • Q9UCR1
    • Q9UCR2
    • Q9UCR3
    • Q9UCR4

    Protein attributes for ENPP2 Gene

    Size:
    863 amino acids
    Molecular mass:
    98994 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for ENPP2 Gene

    Alternative splice isoforms for ENPP2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ENPP2 Gene

Selected DME Specific Peptides for ENPP2 Gene

Q13822:
  • CDGPLSVS
  • PVPTHYYSI
  • EGPPTVLSDSP
  • DFDELCLKTA
  • GWECTKDRCGEVRNE
  • LRGREKFNHRWWGGQPLWITATKQGV
  • TSCLDFTQPAD
  • CLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMY

Post-translational modifications for ENPP2 Gene

  • N-glycosylation, but not furin-cleavage, plays a critical role on secretion and on lysoPLD activity.
  • Glycosylation at isoforms=2, 354, isoforms=2, 3411, isoforms=2, 3525, and Asn807
  • Modification sites at PhosphoSitePlus

Antibody Products

  • R&D Systems Antibodies for ENPP2 (ENPP-2/Autotaxin)
  • Abcam antibodies for ENPP2

Protein Products

  • Abcam proteins for ENPP2

Assay Products

  • Cloud-Clone Corp. Assay Kits for ENPP2

Domains & Families for ENPP2 Gene

Suggested Antigen Peptide Sequences for ENPP2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q13822

UniProtKB/Swiss-Prot:

ENPP2_HUMAN :
  • Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
Family:
  • Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
genes like me logo Genes that share domains with ENPP2: view

No data available for Gene Families for ENPP2 Gene

Function for ENPP2 Gene

Molecular function for ENPP2 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=0.5 mM for 16:0-LPC (at pH 8.5) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; KM=5.5 mM for pNP-TMP (at pH 8.5) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; KM=11.3 mM for pNppp (isoform 1) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; KM=5.7 mM for pNppp (isoform 2) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; KM=19.8 mM for pNppp (isoform 3) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; Vmax=1.9 nmol/min/ug enzyme with pNppp as substrate (isoform 1) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; Vmax=0.67 nmol/min/ug enzyme with pNppp as substrate (isoform 2) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; Vmax=1.6 nmol/min/ug enzyme with pNppp as substrate (isoform 3) {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; pH dependence: Optimum pH is 9.0 (isoform 1), 8.0 (isoform 3). Isoform 1 is less sensitive to pH. Isoform 1, isoform 2 and isoform 3 all retain some activity at pH 9.5. {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805}; Temperature dependence: Isoform 1 and isoform 3 are active from 45 to 60 degrees Celsius. {ECO:0000269 PubMed:12176993, ECO:0000269 PubMed:18175805};
UniProtKB/Swiss-Prot CatalyticActivity:
1-alkyl-sn-glycero-3-phosphoethanolamine + H(2)O = 1-alkyl-sn-glycerol 3-phosphate + ethanolamine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by lysophosphatidic acid (LPA) and sphingosine-1-phosphate (S1P). Inhibited by EDTA and EGTA (Probable).
UniProtKB/Swiss-Prot Function:
Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor.
UniProtKB/Swiss-Prot Induction:
Up-regulated in massively obese subjects with glucose intolerance, and during adipogenesis.

Enzyme Numbers (IUBMB) for ENPP2 Gene

Gene Ontology (GO) - Molecular Function for ENPP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003824 catalytic activity IEA --
GO:0004528 phosphodiesterase I activity IEA --
GO:0004551 nucleotide diphosphatase activity IEA --
GO:0004622 lysophospholipase activity IEA,IDA 15280042
genes like me logo Genes that share ontologies with ENPP2: view
genes like me logo Genes that share phenotypes with ENPP2: view

Animal Models for ENPP2 Gene

MGI Knock Outs for ENPP2:

Animal Model Products

  • Taconic Biosciences Mouse Models for ENPP2

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ENPP2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ENPP2 Gene

Localization for ENPP2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ENPP2 Gene

Secreted. Note=Secreted by most body fluids including serum and CSF. Also by adipocytes and numerous cancer cells.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ENPP2 gene
Compartment Confidence
plasma membrane 5
extracellular 5
golgi apparatus 2
cytoskeleton 1
nucleus 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for ENPP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space ISS --
GO:0005886 plasma membrane TAS 8579579
GO:0005887 integral component of plasma membrane TAS 1733949
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with ENPP2: view

Pathways & Interactions for ENPP2 Gene

genes like me logo Genes that share pathways with ENPP2: view

Pathways by source for ENPP2 Gene

Gene Ontology (GO) - Biological Process for ENPP2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006796 phosphate-containing compound metabolic process TAS 8579579
GO:0006898 receptor-mediated endocytosis IEA --
GO:0006928 movement of cell or subcellular component TAS --
GO:0006935 chemotaxis NAS,IEA 7982964
genes like me logo Genes that share ontologies with ENPP2: view

No data available for SIGNOR curated interactions for ENPP2 Gene

Drugs & Compounds for ENPP2 Gene

(15) Drugs for ENPP2 Gene - From: ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Ethanolamine Experimental Pharma 0
HA 130 Pharma Selective autotaxin inhibitor 0
PF-8380 Pharma Autotaxin inhibitor,potent and specific, Potent autotaxin inhibitor 0
S 32826 Pharma Potent autotaxin inhibitor 0

(80) Additional Compounds for ENPP2 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
LPA(0:0/16:0)
  • 2-Hexadecanoyl-phosphatidic acid
  • 2-Palmitoyl-glycero-3-phosphate
  • LPA(0:0/16:0)
  • LPA(16:0)
  • Lysophosphatidic acid(0:0/16:0)
LPA(0:0/18:0)
  • 2-Octadecanoyl-phosphatidic acid
  • 2-Stearoyl-glycero-3-phosphate
  • LPA(0:0/18:0)
  • LPA(18:0)
  • Lysophosphatidic acid(0:0/18:0)
LPA(0:0/18:1(9Z))
  • 2-(9Z-Octadecenoyl)-phosphatidic acid
  • 2-Oleoyl-glycero-3-phosphate
  • LPA(0:0/18:1)
  • LPA(0:0/18:1n9)
  • LPA(0:0/18:1w9)
LPA(0:0/18:2(9Z,12Z))
  • 2-(9Z,12Z-Octadecadienoyl)-phosphatidic acid
  • 2-Linoleoyl-glycero-3-phosphate
  • LPA(0:0/18:2)
  • LPA(0:0/18:2n6)
  • LPA(0:0/18:2w6)
LPA(16:0/0:0)
  • 1-Hexadecanoyl-phosphatidic acid
  • 1-Palmitoyl lysophosphatidate
  • 1-Palmitoyl lysophosphatidic acid
  • 1-Palmitoyl-glycero-3-phosphate
  • 1-Palmitoylglycerol 3-phosphate

(3) Tocris Compounds for ENPP2 Gene

Compound Action Cas Number
HA 130 Selective autotaxin inhibitor 1229652-21-4
PF 8380 Potent autotaxin inhibitor 1144035-53-9
S 32826 Potent autotaxin inhibitor 1103672-43-0

(3) ApexBio Compounds for ENPP2 Gene

Compound Action Cas Number
HA 130 1229652-21-4
PF-8380 Autotaxin inhibitor,potent and specific 1144035-53-9
S 32826 1103672-43-0
genes like me logo Genes that share compounds with ENPP2: view

Drug Products

Transcripts for ENPP2 Gene

Unigene Clusters for ENPP2 Gene

Ectonucleotide pyrophosphatase/phosphodiesterase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ENPP2

Alternative Splicing Database (ASD) splice patterns (SP) for ENPP2 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19a · 19b ^ 20a · 20b ^ 21 ^ 22 ^ 23 ^
SP1: - -
SP2: - - -
SP3: - -
SP4:

ExUns: 24 ^ 25 ^ 26 ^ 27a · 27b
SP1:
SP2:
SP3:
SP4:

Relevant External Links for ENPP2 Gene

GeneLoc Exon Structure for
ENPP2
ECgene alternative splicing isoforms for
ENPP2

Expression for ENPP2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ENPP2 Gene

mRNA differential expression in normal tissues according to GTEx for ENPP2 Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x8.0) and Brain - Substantia nigra (x4.2).

Protein differential expression in normal tissues from HIPED for ENPP2 Gene

This gene is overexpressed in Vitreous humor (32.0), Cerebrospinal fluid (25.2), and Serum (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ENPP2 Gene



NURSA nuclear receptor signaling pathways regulating expression of ENPP2 Gene:

ENPP2

SOURCE GeneReport for Unigene cluster for ENPP2 Gene:

Hs.190977

mRNA Expression by UniProt/SwissProt for ENPP2 Gene:

Q13822-ENPP2_HUMAN
Tissue specificity: Predominantly expressed in brain, placenta, ovary, and small intestine. Expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. Expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. Not detected in leukocytes. Isoform 1 is more highly expressed in peripheral tissues than in the central nervous system (CNS). Adipocytes only express isoform 1. Isoform 3 is more highly expressed in the brain than in peripheral tissues.

Evidence on tissue expression from TISSUES for ENPP2 Gene

  • Nervous system(5)
  • Eye(2.3)
  • Lung(2.3)
  • Lymph node(2.3)
  • Spleen(2.3)
  • Intestine(2.2)
  • Kidney(2.2)
  • Blood(2.1)
  • Liver(2.1)
genes like me logo Genes that share expression patterns with ENPP2: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for ENPP2 Gene

Orthologs for ENPP2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ENPP2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ENPP2 34 35
  • 99.45 (n)
dog
(Canis familiaris)
Mammalia ENPP2 34 35
  • 92.2 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 91 (a)
OneToMany
-- 35
  • 90 (a)
OneToMany
-- 35
  • 88 (a)
OneToMany
cow
(Bos Taurus)
Mammalia ENPP2 34 35
  • 89.34 (n)
mouse
(Mus musculus)
Mammalia Enpp2 34 16 35
  • 88 (n)
rat
(Rattus norvegicus)
Mammalia Enpp2 34
  • 87.05 (n)
oppossum
(Monodelphis domestica)
Mammalia ENPP2 35
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves ENPP2 34 35
  • 79.86 (n)
lizard
(Anolis carolinensis)
Reptilia ENPP2 35
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia enpp2 34
  • 72.94 (n)
Str.6594 34
zebrafish
(Danio rerio)
Actinopterygii enpp2 34 35 35
  • 66.94 (n)
-- 34
worm
(Caenorhabditis elegans)
Secernentea C27A7.1 35
  • 22 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes NPP2 35
  • 22 (a)
ManyToMany
NPP1 35
  • 20 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 38 (a)
ManyToMany
Species where no ortholog for ENPP2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ENPP2 Gene

ENSEMBL:
Gene Tree for ENPP2 (if available)
TreeFam:
Gene Tree for ENPP2 (if available)

Paralogs for ENPP2 Gene

Paralogs for ENPP2 Gene

(6) SIMAP similar genes for ENPP2 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with ENPP2: view

Variants for ENPP2 Gene

Sequence variations from dbSNP and Humsavar for ENPP2 Gene

SNP ID Clin Chr 08 pos Sequence Context AA Info Type
rs1000074820 -- 119,645,398(+) CACCA(C/T)ATCTA intron-variant
rs1000085405 -- 119,631,200(+) TGCTG(C/T)TATCT intron-variant
rs1000085750 -- 119,628,155(+) TACTA(A/C/G)AAAAT intron-variant
rs1000090933 -- 119,587,850(+) TATTA(C/T)AGAAT intron-variant
rs1000159907 -- 119,589,196(+) CTCTT(A/G)TTTAA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for ENPP2 Gene

Variant ID Type Subtype PubMed ID
esv2668703 CNV deletion 23128226
esv3618603 CNV loss 21293372
nsv612111 CNV gain 21841781

Variation tolerance for ENPP2 Gene

Residual Variation Intolerance Score: 56.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.54; 64.82% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for ENPP2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ENPP2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ENPP2 Gene

Disorders for ENPP2 Gene

MalaCards: The human disease database

(5) MalaCards diseases for ENPP2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
teratocarcinoma
  • mixed embryonal carcinoma and teratoma
intrahepatic cholestasis
  • intrahepatic cholestasis of pregnancy
trichorhinophalangeal syndrome, type i
  • trichorhinophalangeal syndrome type i
neuroblastoma
  • neuroblastoma 1
primary biliary cholangitis
  • familial primary biliary cirrhosis
- elite association - COSMIC cancer census association via MalaCards
Search ENPP2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for ENPP2

Genetic Association Database (GAD)
ENPP2
Human Genome Epidemiology (HuGE) Navigator
ENPP2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
ENPP2
genes like me logo Genes that share disorders with ENPP2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ENPP2 Gene

Publications for ENPP2 Gene

  1. Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/nucleotide pyrophosphatase gene (PDNP2). (PMID: 8586446) Kawagoe H. … Sano K. (Genomics 1995) 2 3 4 22 64
  2. Potential involvement of adipocyte insulin resistance in obesity- associated up-regulation of adipocyte lysophospholipase D/autotaxin expression. (PMID: 15700135) Boucher J. … Saulnier-Blache J.S. (Diabetologia 2005) 3 4 22 64
  3. Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1- phosphate. (PMID: 15769751) van Meeteren L.A. … Moolenaar W.H. (J. Biol. Chem. 2005) 3 4 22 64
  4. Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase. (PMID: 12176993) Tokumura A. … Fukuzawa K. (J. Biol. Chem. 2002) 3 4 22 64
  5. Autotaxin (NPP-2), a metastasis-enhancing mitogen, is an angiogenic factor. (PMID: 11559573) Nam S.W. … Stracke M.L. (Cancer Res. 2001) 3 4 22 64

Products for ENPP2 Gene

  • Addgene plasmids for ENPP2

Sources for ENPP2 Gene

Content
Loading form....