Aliases for DYRK1A Gene
Aliases for DYRK1A Gene
- Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A 2 3 5
- Dual Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2 3
- Dual Specificity YAK1-Related Kinase 3 4
- Protein Kinase Minibrain Homolog 3 4
- DYRK 3 4
- MNBH 3 4
- HP86 3 4
- MNB 3 4
- Dual-Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2
- Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 1A 3
External Ids for DYRK1A Gene
- HGNC: 3091
- Entrez Gene: 1859
- Ensembl: ENSG00000157540
- OMIM: 600855
- UniProtKB: Q13627
Previous HGNC Symbols for DYRK1A Gene
- DYRK1
- DYRK
- MNBH
Previous GeneCards Identifiers for DYRK1A Gene
- GC21P035317
- GC21P037659
- GC21P037712
- GC21P037660
- GC21P037661
- GC21P038739
- GC21P024215
Summaries for DYRK1A Gene
-
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms. [provided by RefSeq, Jul 2008]
GeneCards Summary for DYRK1A Gene
DYRK1A (Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A) is a Protein Coding gene. Diseases associated with DYRK1A include Mental Retardation, Autosomal Dominant 7 and Intellectual Disability Syndrome Due To A Dyrk1a Point Mutation. Among its related pathways are Circadian rythm related genes and Cell cycle Cell cycle (generic schema). GO annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DYRK1B.
UniProtKB/Swiss-Prot for DYRK1A Gene
-
Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
-
Dual-specificity tyrosine phosphorylation-regulated kinases (DYRKs) are conserved serine/threonine kinases. DYRKs have been implicated in cell survival, proliferation and differentiation, and in the pathology of Down Syndrome and Alzheimer's disease.
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DYRK1A Gene
Genomics for DYRK1A Gene
Regulatory Elements for DYRK1A Gene
Enhancers for DYRK1A Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around DYRK1A on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the DYRK1A gene promoter:
Regulatory Element Products
Genomic Location for DYRK1A Gene
- Chromosome:
- 21
- Start:
- 37,365,790 bp from pter
- End:
- 37,517,450 bp from pter
- Size:
- 151,661 bases
- Orientation:
- Plus strand
Genomic View for DYRK1A Gene
Genes around DYRK1A on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 21q22.13 by Ensembl
- 21q22.13 by Entrez Gene
- 21q22.13 by HGNC
DYRK1A Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for DYRK1A Gene
Proteins for DYRK1A Gene
-
Protein details for DYRK1A Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13627-DYR1A_HUMAN
- Recommended name:
- Dual specificity tyrosine-phosphorylation-regulated kinase 1A
- Protein Accession:
- Q13627
- O60769
- Q92582
- Q92810
- Q9UNM5
Protein attributes for DYRK1A Gene
- Size:
- 763 amino acids
- Molecular mass:
- 85584 Da
- Quaternary structure:
-
- Interacts RAD54L2/ARIP4 (By similarity). Interacts with CRY2 (By similarity). Interacts with RANBP9 (PubMed:14500717). Interacts with WDR68 (PubMed:14593110). Interacts with SRSF6 (PubMed:22767602). Interacts with SIRT1 (By similarity).
- (Microbial infection) Interacts with human adenovirus 5 E1A protein (PubMed:23864635).
Three dimensional structures from OCA and Proteopedia for DYRK1A Gene
Protein Expression for DYRK1A Gene
Selected DME Specific Peptides for DYRK1A Gene
- Q13627:
-
- QYSDRRQ
- SHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTL
- HDTEMKYYIVHLK
- AMDCETHSPQVRQQFP
- YDLAIDMWSLGCILVEMHTGEPLFSG
- ALQHSFF
- WMDRYEIDSLIGK
- PYYALQH
- DQIQQPL
- SNPRQETGI
- FRGVSLNLTRK
- IVEVLGIPPA
- EYKPPGTRKLHN
- LSYNLYDLLRNT
- EAPTQVT
- NEVDQMNKIVEVLG
- DLIKTYKHIN
- IGKGSFGQV
- NPKRSAIKI
- QAPKARK
- ETHPVQETTFHV
Post-translational modifications for DYRK1A Gene
- Autophosphorylated on numerous tyrosine residues. Can also autophosphorylate on serine and threonine residues (in vitro).
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for DYRK1A Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for DYRK1A (DYRK1A)
- Cell Signaling Technology (CST) Antibodies for DYRK1A (DYRK1A)
-
Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Novus Biologicals Antibodies for DYRK1A
-
Cloud-Clone Corp. Antibodies for DYRK1A
- Invitrogen Antibodies for DYRK1A
- antibodies-online Antibodies for DYRK1A: See all 117
- GeneTex DYRK1A antibody for DYRK1A
-
Custom Antibody ServicesProSci Antibodies for DYRK1A
-
Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
Protein Products
-
OriGene Purified Proteins for DYRK1A
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- ProSpec Recombinant Proteins for DYRK1A
-
Cloud-Clone Corp. Proteins for DYRK1A
- antibodies-online Proteins for DYRK1A: See all 6
- Search antibodies-online for peptides
- Search GeneTex for Proteins for DYRK1A
Domains & Families for DYRK1A Gene
Gene Families for DYRK1A Gene
Protein Domains for DYRK1A Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for DYRK1A Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q13627UniProtKB/Swiss-Prot:
DYR1A_HUMAN :- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
- Domain:
-
- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
Function for DYRK1A Gene
Molecular function for DYRK1A Gene
- GENATLAS Biochemistry:
- dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1,Drosophila minibrain homolog Dres27,mouse homolog ubiquitously expressed at low levels in embryo,expressed in adult central nervous system -cortex,hippocampus,striatum and spinal cord) located in the Down syndrome critical region (DCR),involved in post-embryonic neurogenesis,putatively overexpressed in Down syndrome and involved in the learning defect and in hypotonia
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by RANBP9 (PubMed:14500717). Inhibited by harmine, leucettamine B and leucettine L41 (PubMed:22998443).
- UniProtKB/Swiss-Prot Function:
- Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
Enzyme Numbers (IUBMB) for DYRK1A Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | TAS | -- |
| GO:0004674 | protein serine/threonine kinase activity | TAS,ISS | 20736167 |
| GO:0004712 | protein serine/threonine/tyrosine kinase activity | IEA | -- |
| GO:0004713 | protein tyrosine kinase activity | ISS | -- |
| GO:0004715 | non-membrane spanning protein tyrosine kinase activity | IDA | 9748265 |
Phenotypes for DYRK1A Gene
- MGI mutant phenotypes for DYRK1A:
-
inferred from 3 alleles
- mortality/aging
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- immune system phenotype
- nervous system phenotype
- cardiovascular system phenotype
- reproductive system phenotype
- endocrine/exocrine gland phenotype
- embryo phenotype
- hematopoietic system phenotype
- liver/biliary system phenotype
- GenomeRNAi human phenotypes for DYRK1A:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Negative genetic interaction between MUS81-/- and MUS81+/+
- shRNA abundance <= 50%
- Mildly decreased CFP-tsO45G cell surface transport
- Increased transferrin (TF) endocytosis
- Decreased viability after Maraba virus infection
- Decreased viability
- Decreased substrate adherent cell growth
- Increased cell death HMECs cells
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased mitotic index
- Decreased 12E8 tau but not total tau protein expression and decreased ratio of 12E8/total tau protein expression
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
Animal Models for DYRK1A Gene
- MGI Knock Outs for DYRK1A:
-
- Dyrk1a tm1Mla
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for DYRK1A
-
-
ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
- Search ViGene Biosciences for DYRK1A
CRISPR Products
-
OriGene CRISPR knockouts for DYRK1A
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
miRNA for DYRK1A Gene
- miRTarBase miRNAs that target DYRK1A
-
- hsa-mir-335-5p (MIRT017031)
- hsa-mir-215-5p (MIRT024657)
- hsa-mir-148a-3p (MIRT026006)
- hsa-mir-192-5p (MIRT026227)
- hsa-mir-324-5p (MIRT043199)
- hsa-mir-99b-5p (MIRT044178)
- hsa-mir-92a-3p (MIRT049774)
- hsa-mir-1246 (MIRT053774)
- hsa-mir-224-3p (MIRT085345)
- hsa-mir-522-3p (MIRT085346)
- hsa-mir-620 (MIRT085347)
- hsa-mir-2113 (MIRT085348)
- hsa-mir-298 (MIRT085349)
- hsa-mir-1270 (MIRT085350)
- hsa-mir-5680 (MIRT085353)
- hsa-mir-6880-5p (MIRT085355)
- hsa-mir-26a-5p (MIRT203408)
- hsa-mir-26b-5p (MIRT203409)
- hsa-mir-455-5p (MIRT203435)
- hsa-mir-2682-3p (MIRT351232)
- hsa-mir-6781-3p (MIRT351238)
- hsa-mir-6844 (MIRT507502)
- hsa-mir-3944-5p (MIRT507503)
- hsa-mir-143-5p (MIRT507504)
- hsa-mir-3165 (MIRT507505)
- hsa-mir-8071 (MIRT507506)
- hsa-mir-4683 (MIRT507507)
- hsa-mir-3152-5p (MIRT642124)
- hsa-mir-6836-3p (MIRT642125)
- hsa-mir-5692a (MIRT642126)
- hsa-mir-335-3p (MIRT668625)
- hsa-mir-30e-3p (MIRT668626)
- hsa-mir-30d-3p (MIRT668627)
- hsa-mir-30a-3p (MIRT668628)
- hsa-mir-550b-2-5p (MIRT668629)
- hsa-mir-3157-5p (MIRT668630)
- hsa-mir-550a-5p (MIRT668631)
- hsa-mir-550a-3-5p (MIRT668632)
- hsa-mir-1271-3p (MIRT668633)
- hsa-mir-3135a (MIRT668634)
- hsa-mir-4716-5p (MIRT668635)
- hsa-mir-5685 (MIRT668636)
- hsa-mir-4690-3p (MIRT668637)
- hsa-mir-7151-5p (MIRT668638)
miRNA Products
- Search ViGene Biosciences for DYRK1A
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for DYRK1A
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
No data available for Transcription Factor Targets and HOMER Transcription for DYRK1A Gene
Localization for DYRK1A Gene
Subcellular locations from UniProtKB/Swiss-Prot for DYRK1A Gene
- Nucleus. Nucleus speckle.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| cytoskeleton | 2 |
| plasma membrane | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | ISS,TAS | -- |
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0016607 | nuclear speck | ISS | -- |
| GO:0030529 | intracellular ribonucleoprotein complex | IEA | -- |
Pathways & Interactions for DYRK1A Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cell Cycle, Mitotic |
.83
|
|
| 2 | Neuroscience | ||
| 3 | Notch signaling pathway (KEGG) | ||
| 4 | Cell cycle Cell cycle (generic schema) |
.31
|
|
| 5 | Mitotic G1-G1/S phases | ||
Pathways by source for DYRK1A Gene
1 Cell Signaling Technology pathway for DYRK1A Gene
2 BioSystems pathways for DYRK1A Gene
4 Reactome pathways for DYRK1A Gene
1 GeneGo (Thomson Reuters) pathway for DYRK1A Gene
1 R&D Systems pathway for DYRK1A Gene
Interacting Proteins for DYRK1A Gene
Selected Interacting proteins:
Q13627-DYR1A_HUMAN
ENSP00000381932
for DYRK1A Gene via
MINT
STRING
IID
UniProtKB
SIGNOR curated interactions for DYRK1A Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | IEA | -- |
| GO:0006468 | protein phosphorylation | ISS | -- |
| GO:0007399 | nervous system development | TAS | 8769099 |
| GO:0007623 | circadian rhythm | ISS | -- |
| GO:0016032 | viral process | IEA | -- |
Drugs & Compounds for DYRK1A Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Adenosine triphosphate | Approved | Nutra | 0 | |||
| N-(5-{[(2S)-4-amino-2-(3-chlorophenyl)butanoyl]amino}-1H-indazol-3-yl)benzamide | Experimental | Pharma | Target | 0 | ||
| ID-8 | Pharma | 0 | ||||
| Harmine | Pharma | Potent and selective DYRK1A inhibitor | 1 | |||
| INDY | Pharma | Dyrk1A and Dyrk1B inhibitor, selective, DYRK1A/B inhibitor | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| AZ 191 |
|
1594092-37-1 |
|
|
||
| TC-S 7004 |
|
1386979-55-0 |
|
|
||
| TG 003 |
|
719277-26-6 |
|
|
(5) Tocris Compounds for DYRK1A Gene
| Compound | Action | Cas Number |
|---|---|---|
| AZ 191 | Potent DYRK1B inhibitor | 1594092-37-1 |
| Harmine | Potent and selective DYRK1A inhibitor | 442-51-3 |
| INDY | DYRK1A/B inhibitor | 1169755-45-6 |
| TC-S 7004 | Potent and selective DYRK1A/B inhibitor | 1386979-55-0 |
| TG 003 | Potent inhibitor of Clk-family kinases; also inhibits DYRK1A/B | 719277-26-6 |
(1) ApexBio Compounds for DYRK1A Gene
| Compound | Action | Cas Number |
|---|---|---|
| ID-8 | 147591-46-6 |
Transcripts for DYRK1A Gene
mRNA/cDNA for DYRK1A Gene
- (20) REFSEQ mRNAs :
- (15) Additional mRNA sequences :
- (287) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for DYRK1A Gene
CRISPR Products
-
OriGene CRISPR knockouts for DYRK1A
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
miRNA Products
- Search ViGene Biosciences for DYRK1A
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for DYRK1A
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
| ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | ||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | |||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - |
Expression for DYRK1A Gene
This gene is overexpressed in Fetal Brain (10.8), Heart (10.1), Peripheral blood mononuclear cells (8.8), Placenta (8.0), and Fetal ovary (7.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DYRK1A Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of DYRK1A Gene:
DYRK1ASOURCE GeneReport for Unigene cluster for DYRK1A Gene:
Hs.368240mRNA Expression by UniProt/SwissProt for DYRK1A Gene:
Q13627-DYR1A_HUMAN
Tissue specificity:
Ubiquitous. Highest levels in skeletal muscle, testis, fetal lung and fetal kidney.
Evidence on tissue expression from TISSUES for DYRK1A Gene
- Nervous system(4.9)
- Liver(4.4)
- Muscle(2.2)
- Blood(2)
- Heart(2)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DYRK1A Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- immune
- integumentary
- nervous
- respiratory
- skeletal muscle
- skeleton
Organs:
Head and neck:
- brain
- cerebellum
- chin
- cranial nerve
- ear
- eye
- eyelid
- face
- forehead
- head
- jaw
- lip
- mandible
- maxilla
- mouth
- nose
- outer ear
- pharynx
- skull
- tooth
Thorax:
- chest wall
- heart
Abdomen:
- abdominal wall
- intestine
- large intestine
Pelvis:
- rectum
Limb:
- digit
- finger
- foot
- hand
- lower limb
- toe
- upper limb
General:
- blood
- blood vessel
- hair
- peripheral nerve
- peripheral nervous system
- skin
- spinal cord
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for DYRK1A
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for DYRK1A Gene
Orthologs for DYRK1A Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | DYRK1A 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | DYRK1A 35 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | DYRK1A 35 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | DYRK1A 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | DYRK1A 34 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Dyrk1a 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Dyrk1a 34 16 35 |
|
||
| chicken (Gallus gallus) |
Aves | DYRK1A 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | DYRK1A 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | dyrk1a 34 |
|
||
| Str.507 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | dyrk1a-prov 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | dyrk1ab 35 |
|
OneToMany | |
| dyrk1aa 34 35 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | mnb 36 35 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | mbk-1 35 36 |
|
OneToMany | |
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YAK1 35 |
|
OneToMany | |
| rice (Oryza sativa) |
Liliopsida | Os.14313 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.1202 35 |
|
OneToMany | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.4844 34 |
|
- Species where no ortholog for DYRK1A was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for DYRK1A Gene
Paralogs for DYRK1A Gene
(14) SIMAP similar genes for DYRK1A Gene using alignment to 4 proteins:
Variants for DYRK1A Gene
| SNP ID | Clin | Chr 21 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1057516030 | Pathogenic | 37,480,786(+) | CGTTA(-/A)CGAAA | intron-variant, reference, frameshift-variant | |
| rs1057518204 | Pathogenic | 37,480,659(+) | AGAAG(C/T)GAAGA | intron-variant, reference, stop-gained | |
| rs1057518580 | Pathogenic | 37,486,527(+) | AGAAC(AAG/TTCTT)AAGGC | intron-variant, upstream-variant-2KB, reference, frameshift-variant | |
| rs1057519402 | Pathogenic | 37,478,270(+) | GTTGA(-/CTTGA)TCAAA | reference, frameshift-variant | |
| rs587776929 | Pathogenic | 37,472,815(+) | CAAAC(-/AT)AAGTG | reference, frameshift-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1270e212 | CNV | loss | 25503493 |
| dgv1271e212 | CNV | loss | 25503493 |
| esv1001034 | CNV | deletion | 20482838 |
| esv3377435 | CNV | insertion | 20981092 |
| esv3646991 | CNV | loss | 21293372 |
| nsv1059823 | CNV | gain | 25217958 |
| nsv1136635 | CNV | deletion | 24896259 |
| nsv834096 | CNV | loss | 17160897 |
| nsv953362 | CNV | duplication | 24416366 |
Residual Variation Intolerance Score:
11.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.30;
25.88% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for DYRK1A Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DYRK1A Gene
Disorders for DYRK1A Gene
(12) MalaCards diseases for DYRK1A Gene - From: OMIM, ClinVar, GeneTests, Orphanet, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| mental retardation, autosomal dominant 7 |
|
|
| intellectual disability syndrome due to a dyrk1a point mutation |
|
|
| down syndrome |
|
|
| dyrk1a-related intellectual disability syndrome due to 21q22.13q22.2 microdeletion |
|
|
| dyrk1a-related intellectual disability syndrome |
|
|
Search DYRK1A in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
DYR1A_HUMAN- Mental retardation, autosomal dominant 7 (MRD7) [MIM:614104]: A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. {ECO:0000269 PubMed:21294719, ECO:0000269 PubMed:23160955}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Relevant External Links for DYRK1A
No data available for Genatlas for DYRK1A Gene
Publications for DYRK1A Gene
- DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. (PMID: 20167603) Guo X. … Li X. (J. Biol. Chem. 2010) 3 4 22 64
- DYRK1A genetic variants are not linked to Alzheimer's disease in a Spanish case-control cohort. (PMID: 19995442) VA!zquez-Higuera J.L. … Combarros O. (BMC Med. Genet. 2009) 3 22 46 64
- Human minibrain homologue (MNBH/DYRK1): characterization, alternative splicing, differential tissue expression, and overexpression in Down syndrome. (PMID: 10329007) Guimera J. … Pritchard M.A. (Genomics 1999) 3 4 22 64
- Minibrain (MNBH) is a single copy gene mapping to human chromosome 21q22.2. (PMID: 9284911) Guimera J. … Estivill X. (Cytogenet. Cell Genet. 1997) 2 3 22 64
- Gene identification in 1.6-Mb region of the Down syndrome region on chromosome 21. (PMID: 9037601) Ohira M. … Ohki M. (Genome Res. 1997) 3 4 22 64
Products for DYRK1A Gene
- R&D Systems Antibodies for DYRK1A (DYRK1A)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for DYRK1A
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- OriGene qPCR primer pairs for DYRK1A
- OriGene CRISPR knockouts for DYRK1A
- OriGene ORF clones in human for DYRK1A
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DYRK1A
- GenScript: Next-day shipping cDNA ORF clone for DYRK1A in any vector
- GenScript Custom Purified and Recombinant Proteins Services for DYRK1A
- GenScript Custom Assay Services for DYRK1A
- GenScript Custom overexpressing Cell Line Services for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for DYRK1A
- Cell Signaling Technology (CST) Antibodies for DYRK1A (DYRK1A)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for DYRK1A
- Novus Biologicals proteins and lysates for DYRK1A
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- ProSpec Recombinant Proteins for DYRK1A
- Cloud-Clone Corp. Antibodies for DYRK1A
- Cloud-Clone Corp. Proteins for DYRK1A
- Cloud-Clone Corp Assay Kits for DYRK1A
- Invitrogen Antibodies for DYRK1A
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for DYRK1A
- Addgene plasmids for DYRK1A
- antibodies-online Antibodies for DYRK1A: See all 117
- antibodies-online Kits for DYRK1A: See all 6
- antibodies-online Proteins for DYRK1A: See all 6
- Search antibodies-online for peptides
- GeneTex DYRK1A antibody for DYRK1A
- Search GeneTex for Proteins for DYRK1A
- ViGene Biosciences adenoviral particle packaged cDNA for DYRK1A gene
- ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
- ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
- Search ViGene Biosciences for DYRK1A
- Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
- Search Santa Cruz Biotechnology (SCBT) for DYRK1A siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- Custom Antibody ServicesProSci Antibodies for DYRK1A
- Search for DYRK1A Proteins at ProSci
- Cyagen custom Knockout/knockin (KOKI) mouse models for DYRK1A
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for DYRK1A Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer