Aliases for DYRK1A Gene
Aliases for DYRK1A Gene
- Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A 2 3 5
- Dual Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2 3
- Dual Specificity YAK1-Related Kinase 3 4
- Protein Kinase Minibrain Homolog 3 4
- DYRK 3 4
- MNBH 3 4
- HP86 3 4
- MNB 3 4
- Dual-Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A 2
- Dual Specificity Tyrosine-Phosphorylation-Regulated Kinase 1A 3
External Ids for DYRK1A Gene
- HGNC: 3091
- Entrez Gene: 1859
- Ensembl: ENSG00000157540
- OMIM: 600855
- UniProtKB: Q13627
Previous HGNC Symbols for DYRK1A Gene
- DYRK1
- DYRK
- MNBH
Previous GeneCards Identifiers for DYRK1A Gene
- GC21P035317
- GC21P037659
- GC21P037712
- GC21P037660
- GC21P037661
- GC21P038739
- GC21P024215
Summaries for DYRK1A Gene
-
This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms. [provided by RefSeq, Jul 2008]
GeneCards Summary for DYRK1A Gene
DYRK1A (Dual Specificity Tyrosine Phosphorylation Regulated Kinase 1A) is a Protein Coding gene. Diseases associated with DYRK1A include Mental Retardation, Autosomal Dominant 7 and Intellectual Disability Syndrome Due To A Dyrk1a Point Mutation. Among its related pathways are T-Cell Receptor and Co-stimulatory Signaling and Regulation of lipid metabolism Insulin signaling-generic cascades. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DYRK1B.
UniProtKB/Swiss-Prot for DYRK1A Gene
-
Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
-
Dual-specificity tyrosine phosphorylation-regulated kinases (DYRKs) are conserved serine/threonine kinases. DYRKs have been implicated in cell survival, proliferation and differentiation, and in the pathology of Down Syndrome and Alzheimer's disease.
Additional gene information for DYRK1A Gene
- Monarch Initiative
- Search for DYRK1A at DataMed
- Search for DYRK1A at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DYRK1A Gene
Genomics for DYRK1A Gene
GeneHancer (GH) Regulatory Elements for DYRK1A Gene
- Top Transcription factor binding sites by QIAGEN in the DYRK1A gene promoter:
Regulatory Element Products
Genomic Locations for DYRK1A Gene
- chr21:37,365,790-37,517,450
- (GRCh38/hg38)
- Size:
- 151,661 bases
- Orientation:
- Plus strand
- chr21:38,738,092-38,889,753
- (GRCh37/hg19)
Genomic View for DYRK1A Gene
- Cytogenetic band:
-
- 21q22.13 by Ensembl
- 21q22.13 by Entrez Gene
- 21q22.13 by HGNC


RefSeq DNA sequence for DYRK1A Gene
Proteins for DYRK1A Gene
-
Protein details for DYRK1A Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13627-DYR1A_HUMAN
- Recommended name:
- Dual specificity tyrosine-phosphorylation-regulated kinase 1A
- Protein Accession:
- Q13627
- O60769
- Q92582
- Q92810
- Q9UNM5
Protein attributes for DYRK1A Gene
- Size:
- 763 amino acids
- Molecular mass:
- 85584 Da
- Quaternary structure:
-
- Interacts RAD54L2/ARIP4 (By similarity). Interacts with CRY2 (By similarity). Interacts with RANBP9 (PubMed:14500717). Interacts with WDR68 (PubMed:14593110). Interacts with SRSF6 (PubMed:22767602). Interacts with SIRT1 (By similarity).
- (Microbial infection) Interacts with human adenovirus 5 E1A protein (PubMed:23864635).
Three dimensional structures from OCA and Proteopedia for DYRK1A Gene
Protein Expression for DYRK1A Gene
Selected DME Specific Peptides for DYRK1A Gene
- Q13627:
-
- QYSDRRQ
- SHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTL
- HDTEMKYYIVHLK
- AMDCETHSPQVRQQFP
- YDLAIDMWSLGCILVEMHTGEPLFSG
- ALQHSFF
- WMDRYEIDSLIGK
- PYYALQH
- DQIQQPL
- SNPRQETGI
- FRGVSLNLTRK
- IVEVLGIPPA
- EYKPPGTRKLHN
- LSYNLYDLLRNT
- EAPTQVT
- NEVDQMNKIVEVLG
- DLIKTYKHIN
- IGKGSFGQV
- NPKRSAIKI
- QAPKARK
- ETHPVQETTFHV
Post-translational modifications for DYRK1A Gene
- Autophosphorylated on numerous tyrosine residues. Can also autophosphorylate on serine and threonine residues (in vitro).
Other Protein References for DYRK1A Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for DYRK1A (DYRK1A)
- Cell Signaling Technology (CST) Antibodies for DYRK1A (DYRK1A)
-
Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Novus Biologicals Antibodies for DYRK1A
-
Abcam antibodies for DYRK1A
-
Cloud-Clone Corp. Antibodies for DYRK1A
- Invitrogen Antibodies for DYRK1A
- GeneTex DYRK1A antibody for DYRK1A
-
Custom Antibody ServicesProSci Antibodies for DYRK1A
-
Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
Protein Products
-
OriGene Purified Proteins for DYRK1A
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- ProSpec Recombinant Proteins for DYRK1A
-
Cloud-Clone Corp. Proteins for DYRK1A
- Search GeneTex for Proteins for DYRK1A
-
Abcam proteins for DYRK1A
Assay Products
-
Cloud-Clone Corp. Assay Kits for DYRK1A
Domains & Families for DYRK1A Gene
Gene Families for DYRK1A Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for DYRK1A Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for DYRK1A Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q13627UniProtKB/Swiss-Prot:
DYR1A_HUMAN :- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
- Domain:
-
- The polyhistidine repeats act as targeting signals to nuclear speckles.
- Family:
-
- Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
Function for DYRK1A Gene
Molecular function for DYRK1A Gene
- GENATLAS Biochemistry:
- dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1,Drosophila minibrain homolog Dres27,mouse homolog ubiquitously expressed at low levels in embryo,expressed in adult central nervous system -cortex,hippocampus,striatum and spinal cord) located in the Down syndrome critical region (DCR),involved in post-embryonic neurogenesis,putatively overexpressed in Down syndrome and involved in the learning defect and in hypotonia
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Inhibited by RANBP9 (PubMed:14500717). Inhibited by harmine, leucettamine B and leucettine L41 (PubMed:22998443).
- UniProtKB/Swiss-Prot Function:
- Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Modulates alternative splicing by phosphorylating the splice factor SRSF6 (By similarity). Exhibits a substrate preference for proline at position P+1 and arginine at position P-3. Has pro-survival function and negatively regulates the apoptotic process. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity).
Enzyme Numbers (IUBMB) for DYRK1A Gene
Phenotypes From GWAS Catalog for DYRK1A Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | TAS | -- |
GO:0004674 | protein serine/threonine kinase activity | TAS,ISS | 20736167 |
GO:0004712 | protein serine/threonine/tyrosine kinase activity | IEA | -- |
GO:0004713 | protein tyrosine kinase activity | ISS | -- |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | IDA | 9748265 |
Phenotypes for DYRK1A Gene
- MGI mutant phenotypes for DYRK1A:
-
inferred from 3 alleles
- nervous system phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- embryo phenotype
- hematopoietic system phenotype
- liver/biliary system phenotype
- GenomeRNAi human phenotypes for DYRK1A:
-
- Increased viability
- Increased vaccinia virus (VACV) infection
- Negative genetic interaction between MUS81-/- and MUS81+/+
- shRNA abundance <= 50%
- Mildly decreased CFP-tsO45G cell surface transport
- Increased transferrin (TF) endocytosis
- Decreased viability after Maraba virus infection
- Decreased viability
- Decreased substrate adherent cell growth
- Increased cell death HMECs cells
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased mitotic index
- Decreased 12E8 tau but not total tau protein expression and decreased ratio of 12E8/total tau protein expression
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
Animal Models for DYRK1A Gene
- MGI Knock Outs for DYRK1A:
-
- Dyrk1a tm1Mla
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for DYRK1A
-
-
ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
- Search ViGene Biosciences for DYRK1A
CRISPR Products
-
OriGene CRISPR knockouts for DYRK1A
- genomics-online: gRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- Applied Biological Materials CRISPR for DYRK1A
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
miRNA for DYRK1A Gene
- miRTarBase miRNAs that target DYRK1A
-
- hsa-mir-335-5p (MIRT017031)
- hsa-mir-215-5p (MIRT024657)
- hsa-mir-148a-3p (MIRT026006)
- hsa-mir-192-5p (MIRT026227)
- hsa-mir-324-5p (MIRT043199)
- hsa-mir-99b-5p (MIRT044178)
- hsa-mir-92a-3p (MIRT049774)
- hsa-mir-1246 (MIRT053774)
- hsa-mir-224-3p (MIRT085345)
- hsa-mir-522-3p (MIRT085346)
- hsa-mir-620 (MIRT085347)
- hsa-mir-2113 (MIRT085348)
- hsa-mir-298 (MIRT085349)
- hsa-mir-1270 (MIRT085350)
- hsa-mir-5680 (MIRT085353)
- hsa-mir-6880-5p (MIRT085355)
- hsa-mir-26a-5p (MIRT203408)
- hsa-mir-26b-5p (MIRT203409)
- hsa-mir-455-5p (MIRT203435)
- hsa-mir-2682-3p (MIRT351232)
- hsa-mir-6781-3p (MIRT351238)
- hsa-mir-6844 (MIRT507502)
- hsa-mir-3944-5p (MIRT507503)
- hsa-mir-143-5p (MIRT507504)
- hsa-mir-3165 (MIRT507505)
- hsa-mir-8071 (MIRT507506)
- hsa-mir-4683 (MIRT507507)
- hsa-mir-3152-5p (MIRT642124)
- hsa-mir-6836-3p (MIRT642125)
- hsa-mir-5692a (MIRT642126)
- hsa-mir-335-3p (MIRT668625)
- hsa-mir-30e-3p (MIRT668626)
- hsa-mir-30d-3p (MIRT668627)
- hsa-mir-30a-3p (MIRT668628)
- hsa-mir-550b-2-5p (MIRT668629)
- hsa-mir-3157-5p (MIRT668630)
- hsa-mir-550a-5p (MIRT668631)
- hsa-mir-550a-3-5p (MIRT668632)
- hsa-mir-1271-3p (MIRT668633)
- hsa-mir-3135a (MIRT668634)
- hsa-mir-4716-5p (MIRT668635)
- hsa-mir-5685 (MIRT668636)
- hsa-mir-4690-3p (MIRT668637)
- hsa-mir-7151-5p (MIRT668638)
miRNA Products
- Search ViGene Biosciences for DYRK1A
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- genomics-online: shRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DYRK1A
- Applied Biological Materials Clones for DYRK1A
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
No data available for Transcription Factor Targets and HOMER Transcription for DYRK1A Gene
Localization for DYRK1A Gene
Subcellular locations from UniProtKB/Swiss-Prot for DYRK1A Gene
- Nucleus. Nucleus speckle.
- Cytosol (2)
- Nucleoli fibrillar center (2)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005634 | nucleus | ISS,TAS | -- |
GO:0005654 | nucleoplasm | TAS | -- |
GO:0005737 | cytoplasm | TAS | 24327345 |
GO:0005856 | colocalizes_with cytoskeleton | IDA | 24327345 |
GO:0016607 | nuclear speck | TAS,ISS | 28377597 |
Pathways & Interactions for DYRK1A Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Cell Cycle, Mitotic |
.83
|
|
2 | Neuroscience | ||
3 | Notch signaling pathway (KEGG) | ||
4 | Cell cycle Cell cycle (generic schema) |
.31
|
|
5 | Mitotic G1-G1/S phases |
Pathways by source for DYRK1A Gene
1 Cell Signaling Technology pathway for DYRK1A Gene
2 BioSystems pathways for DYRK1A Gene
4 Reactome pathways for DYRK1A Gene
1 GeneGo (Thomson Reuters) pathway for DYRK1A Gene
1 R&D Systems pathway for DYRK1A Gene
Interacting Proteins for DYRK1A Gene
SIGNOR curated interactions for DYRK1A Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | IEA | -- |
GO:0006468 | protein phosphorylation | TAS,ISS | 24327345 |
GO:0007399 | nervous system development | TAS | 8769099 |
GO:0007623 | circadian rhythm | ISS | -- |
GO:0016032 | viral process | IEA | -- |
Drugs & Compounds for DYRK1A Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
N-(5-{[(2S)-4-amino-2-(3-chlorophenyl)butanoyl]amino}-1H-indazol-3-yl)benzamide | Experimental | Pharma | Target | 0 | ||
ATP | Investigational | Nutra | Agonist | 0 | ||
ID-8 | Pharma | 0 | ||||
Harmine | Pharma | Potent and selective DYRK1A inhibitor | 1 | |||
INDY | Pharma | Dyrk1A and Dyrk1B inhibitor, selective, DYRK1A/B inhibitor | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
(3) Tocris Compounds for DYRK1A Gene
(1) ApexBio Compounds for DYRK1A Gene
Compound | Action | Cas Number |
---|---|---|
ID-8 | 147591-46-6 |
Transcripts for DYRK1A Gene
mRNA/cDNA for DYRK1A Gene
- (20) REFSEQ mRNAs :
- (15) Additional mRNA sequences :
- (287) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for DYRK1A Gene
CRISPR Products
-
OriGene CRISPR knockouts for DYRK1A
- genomics-online: gRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- Applied Biological Materials CRISPR for DYRK1A
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
miRNA Products
- Search ViGene Biosciences for DYRK1A
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- genomics-online: shRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DYRK1A
- Applied Biological Materials Clones for DYRK1A
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | ^ | 3 | ^ | 4a | · | 4b | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | ||||||||||||||||||||||||||||||||||||||
SP2: | - | - | |||||||||||||||||||||||||||||||||||||
SP3: | - | ||||||||||||||||||||||||||||||||||||||
SP4: | - | - | - | ||||||||||||||||||||||||||||||||||||
SP5: | - | - | - | - | |||||||||||||||||||||||||||||||||||
SP6: | - | - | - | - | - |
Expression for DYRK1A Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DYRK1A Gene
NURSA nuclear receptor signaling pathways regulating expression of DYRK1A Gene:
DYRK1ASOURCE GeneReport for Unigene cluster for DYRK1A Gene:
Hs.368240mRNA Expression by UniProt/SwissProt for DYRK1A Gene:
Q13627-DYR1A_HUMANEvidence on tissue expression from TISSUES for DYRK1A Gene
- Nervous system(4.9)
- Liver(4.4)
- Muscle(2.3)
- Blood(2.1)
- Heart(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DYRK1A Gene
- ectoderm
- endoderm
- mesoderm
- cardiovascular
- digestive
- immune
- integumentary
- nervous
- respiratory
- skeletal muscle
- skeleton
- brain
- cerebellum
- chin
- cranial nerve
- ear
- eye
- eyelid
- face
- forehead
- head
- jaw
- lip
- mandible
- maxilla
- mouth
- nose
- outer ear
- pharynx
- skull
- tooth
- chest wall
- heart
- abdominal wall
- intestine
- large intestine
- rectum
- digit
- finger
- foot
- hand
- lower limb
- toe
- upper limb
- blood
- blood vessel
- hair
- peripheral nerve
- peripheral nervous system
- skin
- spinal cord
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for DYRK1A
- genomics-online: primer clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for DYRK1A Gene
Orthologs for DYRK1A Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | DYRK1A 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | DYRK1A 34 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | DYRK1A 34 |
|
OneToOne | |
dog (Canis familiaris) |
Mammalia | DYRK1A 34 33 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | DYRK1A 34 33 |
|
OneToOne | |
rat (Rattus norvegicus) |
Mammalia | Dyrk1a 33 |
|
||
mouse (Mus musculus) |
Mammalia | Dyrk1a 33 16 34 |
|
||
chicken (Gallus gallus) |
Aves | DYRK1A 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | DYRK1A 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | dyrk1a 33 |
|
||
Str.507 33 |
|
||||
African clawed frog (Xenopus laevis) |
Amphibia | dyrk1a-prov 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | dyrk1ab 34 |
|
OneToMany | |
dyrk1aa 33 34 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | mnb 35 34 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | mbk-1 34 35 |
|
OneToMany | |
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YAK1 34 |
|
OneToMany | |
rice (Oryza sativa) |
Liliopsida | Os.14313 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | CSA.1202 34 |
|
OneToMany | |
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.4844 33 |
|
- Species where no ortholog for DYRK1A was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for DYRK1A Gene
Paralogs for DYRK1A Gene
(14) SIMAP similar genes for DYRK1A Gene using alignment to 4 proteins:
Variants for DYRK1A Gene
SNP ID | Clin | Chr 21 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1039571136 | likely-pathogenic, pathogenic, not provided, Mental retardation, autosomal dominant 7 | 37,490,442(+) | C/A/T | coding_sequence_variant, missense_variant | |
rs1049764 | likely-benign, not specified, Mental retardation, autosomal dominant 7 | 37,478,234(+) | C/T | coding_sequence_variant, genic_upstream_transcript_variant, synonymous_variant | |
rs1057175147 | uncertain-significance, Mental retardation, autosomal dominant 7 | 37,472,720(+) | G/A/T | 5_prime_UTR_variant, coding_sequence_variant, genic_upstream_transcript_variant, missense_variant | |
rs1057516030 | pathogenic, Mental retardation, autosomal dominant 7 | 37,480,786(+) | A/AA | coding_sequence_variant, genic_upstream_transcript_variant, stop_gained | |
rs1057518204 | pathogenic, not provided, Mental retardation, autosomal dominant 7 | 37,480,659(+) | C/T | coding_sequence_variant, genic_upstream_transcript_variant, stop_gained |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv1270e212 | CNV | loss | 25503493 |
dgv1271e212 | CNV | loss | 25503493 |
esv1001034 | CNV | deletion | 20482838 |
esv3377435 | CNV | insertion | 20981092 |
esv3646991 | CNV | loss | 21293372 |
nsv1059823 | CNV | gain | 25217958 |
nsv1136635 | CNV | deletion | 24896259 |
nsv834096 | CNV | loss | 17160897 |
nsv953362 | CNV | duplication | 24416366 |
Additional Variant Information for DYRK1A Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DYRK1A Gene
Disorders for DYRK1A Gene

(13) MalaCards diseases for DYRK1A Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
mental retardation, autosomal dominant 7 |
|
|
intellectual disability syndrome due to a dyrk1a point mutation |
|
|
microcephaly |
|
|
visual epilepsy |
|
|
seizure disorder |
|
|
UniProtKB/Swiss-Prot
DYR1A_HUMAN- Mental retardation, autosomal dominant 7 (MRD7) [MIM:614104]: A disease characterized by primary microcephaly, severe mental retardation without speech, anxious autistic behavior, and dysmorphic features, including bitemporal narrowing, deep-set eyes, large simple ears, and a pointed nasal tip. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. {ECO:0000269 PubMed:21294719, ECO:0000269 PubMed:23160955}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for DYRK1A
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for DYRK1A Gene
Publications for DYRK1A Gene
- DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. (PMID: 20167603) Guo X … Li X (The Journal of biological chemistry 2010) 3 4 22 58
- DYRK1A genetic variants are not linked to Alzheimer's disease in a Spanish case-control cohort. (PMID: 19995442) Vázquez-Higuera JL … Combarros O (BMC medical genetics 2009) 3 22 44 58
- Human minibrain homologue (MNBH/DYRK1): characterization, alternative splicing, differential tissue expression, and overexpression in Down syndrome. (PMID: 10329007) Guimera J … Pritchard M (Genomics 1999) 3 4 22 58
- Gene identification in 1.6-Mb region of the Down syndrome region on chromosome 21. (PMID: 9037601) Ohira M … Ohki M (Genome research 1997) 3 4 22 58
- Minibrain (MNBH) is a single copy gene mapping to human chromosome 21q22.2. (PMID: 9284911) Guimera J … Estivill X (Cytogenetics and cell genetics 1997) 2 3 22 58
Products for DYRK1A Gene
- R&D Systems Antibodies for DYRK1A (DYRK1A)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for DYRK1A
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for DYRK1A
- Search Origene for MassSpec and Protein Over-expression Lysates for DYRK1A
- Origene Custom Protein Services for DYRK1A
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DYRK1A
- Browse OriGene Inhibitory RNA Products For DYRK1A
- OriGene qPCR primer pairs for DYRK1A
- OriGene CRISPR knockouts for DYRK1A
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DYRK1A
- GenScript: Next-day shipping of latest version cDNA ORF clones for DYRK1A in any vector
- GenScript Custom Purified and Recombinant Proteins Services for DYRK1A
- GenScript Custom Assay Services for DYRK1A
- GenScript Custom overexpressing Cell Line Services for DYRK1A
- GenScript: Design CRISPR guide RNA sequences for DYRK1A
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for DYRK1A
- Cell Signaling Technology (CST) Antibodies for DYRK1A (DYRK1A)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for DYRK1A
- Novus Biologicals proteins and lysates for DYRK1A
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for DYRK1A
- Abcam proteins for DYRK1A
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for DYRK1A
- Cloud-Clone Corp. Antibodies for DYRK1A
- Cloud-Clone Corp. Proteins for DYRK1A
- Cloud-Clone Corp. Assay Kits for DYRK1A
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for DYRK1A
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for DYRK1A
- Cyagen custom Knockout/knockin (KOKI) mouse models for DYRK1A
- VectorBuilder custom plasmid, inducible vectors for DYRK1A
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DYRK1A
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DYRK1A
- antibodies-online: Search results for 134 available DYRK1A Antibodies ranked by validation data
- Compare Top DYRK1A Antibodies
- antibodies-online: Search results for 8 available DYRK1A Elisa Kits ranked by validation data
- Compare Top DYRK1A Elisa Kits
- Recommended
- antibodies-online: Search results for 8 available DYRK1A Proteins ranked by validation data
- Compare Top DYRK1A Proteins
- GeneTex DYRK1A antibody for DYRK1A
- Search GeneTex for Proteins for DYRK1A
- ViGene Biosciences adenoviral particle packaged cDNA for DYRK1A gene
- ViGene Biosciences lentiviral particle packaged cDNA for DYRK1A gene
- ViGene Biosciences ready-to-package AAV shRNAs for DYRK1A gene
- Search ViGene Biosciences for DYRK1A
- Santa Cruz Biotechnology (SCBT) Antibodies for DYRK1A
- Search Santa Cruz Biotechnology (SCBT) for DYRK1A siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DYRK1A
- genomics-online: cdna clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- orf clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- genomics-online: gRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- genomics-online: primer clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
- genomics-online: shRNA clones - Search results for 107 available DYRK1A gene related products
- Overview of 107 available DYRK1A gene related products
Sources for DYRK1A Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew