Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DSTYK Gene

Aliases for DSTYK Gene

  • Dual Serine/Threonine And Tyrosine Protein Kinase 2 3 5
  • Receptor-Interacting Serine/Threonine-Protein Kinase 5 3 4
  • RIP-Homologous Kinase 3 4
  • Dusty Protein Kinase 3 4
  • Sugen Kinase 496 3 4
  • EC 2.7.12.1 4 61
  • Dusty PK 3 4
  • SgK496 3 4
  • RIPK5 3 4
  • RIP5 3 4
  • Receptor Interacting Protein Kinase 5 2
  • HDCMD38P 3
  • KIAA0472 4
  • DustyPK 3
  • CAKUT1 3
  • SPG23 3

External Ids for DSTYK Gene

Previous HGNC Symbols for DSTYK Gene

  • RIPK5

Previous GeneCards Identifiers for DSTYK Gene

  • GC01M203379
  • GC01M176276

Summaries for DSTYK Gene

Entrez Gene Summary for DSTYK Gene

  • This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. It is thought to function as a regulator of cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

GeneCards Summary for DSTYK Gene

DSTYK (Dual Serine/Threonine And Tyrosine Protein Kinase) is a Protein Coding gene. Diseases associated with DSTYK include Congenital Anomalies Of Kidney And Urinary Tract and Spastic Paraplegia 23. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity.

UniProtKB/Swiss-Prot for DSTYK Gene

  • Acts as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation. May induce both caspase-dependent apoptosis and caspase-independent cell death.

Gene Wiki entry for DSTYK Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DSTYK Gene

Genomics for DSTYK Gene

Regulatory Elements for DSTYK Gene

Enhancers for DSTYK Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G205246 1.7 FANTOM5 Ensembl ENCODE dbSUPER 29.7 -37.4 -37389 5.1 HDGF HDAC1 ATF1 PTBP1 ARNT TCF12 ZNF121 GLIS2 GATA2 CREM TMCC2 DSTYK CNTN2 CDK18 NUAK2 TMEM81 LOC101929459 NFASC MFSD4A PIR41674
GH01G205283 2 FANTOM5 Ensembl ENCODE dbSUPER 18.8 -74.8 -74816 5.6 HDGF PKNOX1 MLX CREB3L1 ARNT WRNIP1 ARID4B SIN3A DMAP1 ZNF2 TMCC2 NUAK2 DSTYK LOC101929459 RBBP5 RAB29 PIR41674
GH01G205258 1.9 FANTOM5 Ensembl ENCODE dbSUPER 18.8 -47.8 -47755 2.5 HDGF PKNOX1 ARNT SIN3A FEZF1 ZNF2 ZBTB7B ZNF766 ZNF143 FOS TMCC2 DSTYK ELK4 MDM4 GYG2P2 LOC101929459 NUAK2 RBBP5 KLHDC8A CNTN2
GH01G205293 2 FANTOM5 Ensembl ENCODE dbSUPER 17.3 -87.7 -87682 12.4 HDGF PKNOX1 FOXA2 ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF766 TMCC2 NUAK2 DSTYK CDK18 LOC101929459 MFSD4A CNTN2 TMEM81 KLHDC8A ELK4
GH01G205174 1.6 FANTOM5 Ensembl ENCODE 18.1 +35.4 35397 2.7 HDGF SIN3A GTF3C2 FOS JUNB TSHZ1 ZNF592 MEF2D NFIL3 MAFF DSTYK GYG2P2 ELK4 MDM4 LOC100420878 CNTN2 PPP1R15B GC01P205170 RPL17P8
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DSTYK on UCSC Golden Path with GeneCards custom track

Promoters for DSTYK Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000018737 399 2001 CREB3L1 AGO1 ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3

Genomic Location for DSTYK Gene

Chromosome:
1
Start:
205,142,503 bp from pter
End:
205,211,599 bp from pter
Size:
69,097 bases
Orientation:
Minus strand

Genomic View for DSTYK Gene

Genes around DSTYK on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DSTYK Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DSTYK Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DSTYK Gene

Proteins for DSTYK Gene

  • Protein details for DSTYK Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q6XUX3-DUSTY_HUMAN
    Recommended name:
    Dual serine/threonine and tyrosine protein kinase
    Protein Accession:
    Q6XUX3
    Secondary Accessions:
    • B7ZL64
    • O75060
    • Q17R94
    • Q5RKT0
    • Q6IN87
    • Q6P997
    • Q86Y03
    • Q9P1S5

    Protein attributes for DSTYK Gene

    Size:
    929 amino acids
    Molecular mass:
    105206 Da
    Quaternary structure:
    No Data Available

    Alternative splice isoforms for DSTYK Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DSTYK Gene

Selected DME Specific Peptides for DSTYK Gene

Q6XUX3:
  • ERLHRDLY
  • ELIISRLNQAV
  • FDEECWQLMEACW
  • EEKYLQQIVD
  • KSVVPPD
  • ELGRGQYGVVYLCD
  • SVDVYAFGILFWY
  • GKYDNSVD
  • PGQDTKAQS
  • SVDYLRESFVGTLERCL
  • KITDLGFCKPEAMMSGSIVGTPIHMAPELF
  • RPLLGIVQP
  • NDFLPVITYALHKDELSER
  • TQKFFRD
  • CASKDHLWNNVR
  • KENELYESLM
  • KCQLLNLLL
  • YELVHTL
  • DLWLRVRKDHAPRLARLSLESRSL
  • DVSVHITSNYLKQILNAAYHVEVTFHSGS
  • WKRKVAQ
  • LVDAAKALN
  • SICSQFRTRL
  • GSVKLPEAFE
  • VRKDHAPRLARLSLESRSLQDVLLH
  • LNAAYHVEVTFHSGSSVTR
  • IANRKQEEMK
  • KHWNDLALEFHY
  • VVAPCQGLRP
  • AFDMQRD
  • ETLNTMK
  • RLNQAVANKL
  • WEQIKQII

Post-translational modifications for DSTYK Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for DSTYK Gene

Domains & Families for DSTYK Gene

Gene Families for DSTYK Gene

Suggested Antigen Peptide Sequences for DSTYK Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q6XUX3

UniProtKB/Swiss-Prot:

DUSTY_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
genes like me logo Genes that share domains with DSTYK: view

Function for DSTYK Gene

Molecular function for DSTYK Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Acts as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation. May induce both caspase-dependent apoptosis and caspase-independent cell death.

Enzyme Numbers (IUBMB) for DSTYK Gene

Gene Ontology (GO) - Molecular Function for DSTYK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IBA,IEA --
GO:0004712 protein serine/threonine/tyrosine kinase activity IEA --
GO:0004713 protein tyrosine kinase activity IEA --
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with DSTYK: view
genes like me logo Genes that share phenotypes with DSTYK: view

Human Phenotype Ontology for DSTYK Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

  • Taconic Biosciences Mouse Models for DSTYK

CRISPR Products

miRNA for DSTYK Gene

miRTarBase miRNAs that target DSTYK

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DSTYK

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for DSTYK Gene

Localization for DSTYK Gene

Subcellular locations from UniProtKB/Swiss-Prot for DSTYK Gene

Cytoplasm. Cell membrane. Apical cell membrane. Basolateral cell membrane. Cell junction. Note=Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane (By similarity). Detected in basolateral and apical membranes of all tubular epithelia. {ECO:0000250 UniProtKB:Q6XUX1, ECO:0000269 PubMed:23862974}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DSTYK gene
Compartment Confidence
plasma membrane 5
cytosol 4
nucleus 3
cytoskeleton 2

Gene Ontology (GO) - Cellular Components for DSTYK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 23862974
GO:0005829 cytosol IBA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
GO:0016323 basolateral plasma membrane IDA,IEA 23862974
genes like me logo Genes that share ontologies with DSTYK: view

Pathways & Interactions for DSTYK Gene

SuperPathways for DSTYK Gene

No Data Available

Gene Ontology (GO) - Biological Process for DSTYK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0016310 phosphorylation IEA --
GO:0018108 peptidyl-tyrosine phosphorylation IEA --
GO:0033674 positive regulation of kinase activity IMP 23862974
GO:0043066 negative regulation of apoptotic process IMP 28157540
genes like me logo Genes that share ontologies with DSTYK: view

No data available for Pathways by source and SIGNOR curated interactions for DSTYK Gene

Drugs & Compounds for DSTYK Gene

(1) Drugs for DSTYK Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for DSTYK Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with DSTYK: view

Transcripts for DSTYK Gene

Unigene Clusters for DSTYK Gene

Dual serine/threonine and tyrosine protein kinase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DSTYK

Alternative Splicing Database (ASD) splice patterns (SP) for DSTYK Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13a · 13b
SP1: -
SP2: - -
SP3:
SP4: - - - - - - - -

Relevant External Links for DSTYK Gene

GeneLoc Exon Structure for
DSTYK
ECgene alternative splicing isoforms for
DSTYK

Expression for DSTYK Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DSTYK Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for DSTYK Gene

This gene is overexpressed in Adrenal (30.2) and Adipocyte (26.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DSTYK Gene



NURSA nuclear receptor signaling pathways regulating expression of DSTYK Gene:

DSTYK

SOURCE GeneReport for Unigene cluster for DSTYK Gene:

Hs.6874

mRNA Expression by UniProt/SwissProt for DSTYK Gene:

Q6XUX3-DUSTY_HUMAN
Tissue specificity: Predominantly expressed in skeletal muscle and testis. Expressed in basolateral and apical membranes of all tubular epithelia. Expressed in thin ascending limb of the loop of Henle and the distal convoluted tubule. Expressed in all layers of transitional ureteric epithelium and in the ureteric smooth-muscle cells. Weakly expressed in heart, brain, placenta, kidney, pancreas, spleen, thymus, prostate, uterus, small intestine, white blood cells, stomach, spinal cord and adrenal gland. Is widely distributed in the CNS. Also detected in several tumor cell lines.

Evidence on tissue expression from TISSUES for DSTYK Gene

  • Nervous system(4.6)
  • Skin(4.4)
  • Eye(4.3)
  • Lymph node(4.2)
  • Muscle(4.2)
  • Spleen(4.2)
  • Blood(4)

Phenotype-based relationships between genes and organs from Gene ORGANizer for DSTYK Gene

Germ Layers:
  • endoderm
  • mesoderm
Systems:
  • urinary
Organs:
Abdomen:
  • kidney
Pelvis:
  • ureter
  • urinary bladder
genes like me logo Genes that share expression patterns with DSTYK: view

Primer Products

No data available for mRNA differential expression in normal tissues and Protein tissue co-expression partners for DSTYK Gene

Orthologs for DSTYK Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for DSTYK Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DSTYK 34 35
  • 99.78 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 94 (a)
OneToMany
-- 35
  • 92 (a)
OneToMany
cow
(Bos Taurus)
Mammalia DSTYK 34 35
  • 91.56 (n)
dog
(Canis familiaris)
Mammalia DSTYK 34 35
  • 90.56 (n)
mouse
(Mus musculus)
Mammalia Dstyk 34 16 35
  • 88.53 (n)
rat
(Rattus norvegicus)
Mammalia Dstyk 34
  • 88.03 (n)
chicken
(Gallus gallus)
Aves DSTYK 34 35
  • 74.68 (n)
lizard
(Anolis carolinensis)
Reptilia DSTYK 35
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dstyk 34
  • 68.99 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.5447 34
zebrafish
(Danio rerio)
Actinopterygii dstyk 34 35
  • 67.19 (n)
Dr.13169 34
fruit fly
(Drosophila melanogaster)
Insecta png 35
  • 20 (a)
ManyToMany
Wsck 35
  • 15 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea Y47G6A.5 35
  • 13 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CDC15 35
  • 10 (a)
OneToMany
Species where no ortholog for DSTYK was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • oppossum (Monodelphis domestica)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DSTYK Gene

ENSEMBL:
Gene Tree for DSTYK (if available)
TreeFam:
Gene Tree for DSTYK (if available)

Paralogs for DSTYK Gene

(1) SIMAP similar genes for DSTYK Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with DSTYK: view

No data available for Paralogs for DSTYK Gene

Variants for DSTYK Gene

Sequence variations from dbSNP and Humsavar for DSTYK Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs200780796 other, Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805] 205,211,450(+) AGCCC(C/T)GGCAC upstream-variant-2KB, reference, missense
rs778586547 Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805] 205,148,279(+) AGCCT(A/G)AGCAG intron-variant, reference, missense
VAR_071325 Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805]
rs148815814 Uncertain significance 205,162,079(+) TGAGC(C/T)GAGTC reference, missense
rs202068245 Uncertain significance 205,211,483(+) CGCCG(A/G)GGCCG upstream-variant-2KB, reference, missense

Structural Variations from Database of Genomic Variants (DGV) for DSTYK Gene

Variant ID Type Subtype PubMed ID
dgv563n100 CNV gain 25217958
esv1503810 OTHER inversion 17803354
esv2721906 CNV deletion 23290073
esv2721918 CNV deletion 23290073
esv3414627 CNV insertion 20981092
esv3588631 OTHER inversion 21293372
esv7237 OTHER inversion 19470904
nsv1079018 OTHER inversion 25765185
nsv1141904 OTHER inversion 24896259
nsv468016 CNV loss 19166990
nsv549042 CNV loss 21841781
nsv946605 CNV duplication 23825009

Variation tolerance for DSTYK Gene

Residual Variation Intolerance Score: 34.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.40; 63.69% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DSTYK Gene

Human Gene Mutation Database (HGMD)
DSTYK
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DSTYK

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DSTYK Gene

Disorders for DSTYK Gene

MalaCards: The human disease database

(4) MalaCards diseases for DSTYK Gene - From: OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
congenital anomalies of kidney and urinary tract
  • renal hypodysplasia, nonsyndromic, 1
spastic paraplegia 23
  • hereditary spastic paraplegia 23
renal agenesis, unilateral
posterior urethral valves
  • posterior urethral valve
- elite association - COSMIC cancer census association via MalaCards
Search DSTYK in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

DUSTY_HUMAN
  • Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805]: A disorder encompassing a broad spectrum of renal and urinary tract malformations that include renal agenesis, kidney hypodysplasia, multicystic kidney dysplasia, duplex collecting system, posterior urethral valves and ureter abnormalities. Congenital anomalies of kidney and urinary tract are the commonest cause of chronic kidney disease in children. {ECO:0000269 PubMed:23862974}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

Relevant External Links for DSTYK

Genetic Association Database (GAD)
DSTYK
Human Genome Epidemiology (HuGE) Navigator
DSTYK
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DSTYK
genes like me logo Genes that share disorders with DSTYK: view

No data available for Genatlas for DSTYK Gene

Publications for DSTYK Gene

  1. RIP5 is a RIP-homologous inducer of cell death. (PMID: 15178406) Zha J. … Shu H.B. (Biochem. Biophys. Res. Commun. 2004) 2 3 4 64
  2. Mutations in DSTYK and dominant urinary tract malformations. (PMID: 23862974) Sanna-Cherchi S. … Gharavi A.G. (N. Engl. J. Med. 2013) 3 4 64
  3. Dusty protein kinases: primary structure, gene evolution, tissue specific expression and unique features of the catalytic domain. (PMID: 17123648) Peng J. … Huang C.-H. (Biochim. Biophys. Acta 2006) 3 4 64
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  5. Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. (PMID: 9455484) Seki N. … Ohara O. (DNA Res. 1997) 3 4 64

Products for DSTYK Gene

  • Addgene plasmids for DSTYK

Sources for DSTYK Gene

Content
Loading form....