Aliases for DSTYK Gene
Aliases for DSTYK Gene
External Ids for DSTYK Gene
- HGNC: 29043
- Entrez Gene: 25778
- Ensembl: ENSG00000133059
- OMIM: 612666
- UniProtKB: Q6XUX3
Previous HGNC Symbols for DSTYK Gene
- RIPK5
Previous GeneCards Identifiers for DSTYK Gene
- GC01M203379
- GC01M176276
Summaries for DSTYK Gene
-
This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. It is thought to function as a regulator of cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
GeneCards Summary for DSTYK Gene
DSTYK (Dual Serine/Threonine And Tyrosine Protein Kinase) is a Protein Coding gene. Diseases associated with DSTYK include Congenital Anomalies Of Kidney And Urinary Tract 1 and Spastic Paraplegia 23. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity.
UniProtKB/Swiss-Prot for DSTYK Gene
-
Acts as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation (PubMed:23862974, PubMed:28157540). Involved in the regulation of both caspase-dependent apoptosis and caspase-independent cell death (PubMed:15178406). In the skin, it plays a predominant role in suppressing caspase-dependent apoptosis in response to UV stress in a range of dermal cell types (PubMed:28157540).
Additional gene information for DSTYK Gene
- Monarch Initiative
- Search for DSTYK at DataMed
- Search for DSTYK at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DSTYK Gene
Genomics for DSTYK Gene
GeneHancer (GH) Regulatory Elements for DSTYK Gene
Regulatory Element Products
Genomic Locations for DSTYK Gene
- chr1:205,142,503-205,211,599
- (GRCh38/hg38)
- Size:
- 69,097 bases
- Orientation:
- Minus strand
- chr1:205,111,631-205,180,727
- (GRCh37/hg19)
Genomic View for DSTYK Gene
- Cytogenetic band:
-
- 1q32.1 by Ensembl
- 1q32.1 by Entrez Gene
- 1q32.1 by HGNC


RefSeq DNA sequence for DSTYK Gene
Proteins for DSTYK Gene
-
Protein details for DSTYK Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q6XUX3-DUSTY_HUMAN
- Recommended name:
- Dual serine/threonine and tyrosine protein kinase
- Protein Accession:
- Q6XUX3
- B7ZL64
- O75060
- Q17R94
- Q5RKT0
- Q6IN87
- Q6P997
- Q86Y03
- Q9P1S5
Protein attributes for DSTYK Gene
- Size:
- 929 amino acids
- Molecular mass:
- 105206 Da
- Quaternary structure:
- No Data Available
Protein Expression for DSTYK Gene
Selected DME Specific Peptides for DSTYK Gene
- Q6XUX3:
-
- ERLHRDLY
- ELIISRLNQAV
- FDEECWQLMEACW
- EEKYLQQIVD
- KSVVPPD
- ELGRGQYGVVYLCD
- SVDVYAFGILFWY
- GKYDNSVD
- PGQDTKAQS
- SVDYLRESFVGTLERCL
- KITDLGFCKPEAMMSGSIVGTPIHMAPELF
- RPLLGIVQP
- NDFLPVITYALHKDELSER
- TQKFFRD
- CASKDHLWNNVR
- KENELYESLM
- KCQLLNLLL
- YELVHTL
- DLWLRVRKDHAPRLARLSLESRSL
- DVSVHITSNYLKQILNAAYHVEVTFHSGS
- WKRKVAQ
- LVDAAKALN
- SICSQFRTRL
- GSVKLPEAFE
- VRKDHAPRLARLSLESRSLQDVLLH
- LNAAYHVEVTFHSGSSVTR
- IANRKQEEMK
- KHWNDLALEFHY
- VVAPCQGLRP
- AFDMQRD
- ETLNTMK
- RLNQAVANKL
- WEQIKQII
Post-translational modifications for DSTYK Gene
Other Protein References for DSTYK Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for DSTYK
- Invitrogen Antibodies for DSTYK
- GeneTex DSTYK antibody for DSTYK
-
Santa Cruz Biotechnology (SCBT) Antibodies for DSTYK
Protein Products
-
OriGene Purified Proteins for DSTYK
- Search Origene for MassSpec and Protein Over-expression Lysates for DSTYK
- Origene Custom Protein Services for DSTYK
- Search GeneTex for Proteins for DSTYK
-
Abcam proteins for DSTYK
Assay Products
Domains & Families for DSTYK Gene
Gene Families for DSTYK Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
Protein Domains for DSTYK Gene
Suggested Antigen Peptide Sequences for DSTYK Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q6XUX3UniProtKB/Swiss-Prot:
DUSTY_HUMAN :- Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
- Family:
-
- Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Function for DSTYK Gene
Molecular function for DSTYK Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot Function:
- Acts as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation (PubMed:23862974, PubMed:28157540). Involved in the regulation of both caspase-dependent apoptosis and caspase-independent cell death (PubMed:15178406). In the skin, it plays a predominant role in suppressing caspase-dependent apoptosis in response to UV stress in a range of dermal cell types (PubMed:28157540).
Enzyme Numbers (IUBMB) for DSTYK Gene
Phenotypes From GWAS Catalog for DSTYK Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0004672 | protein kinase activity | IEA | -- |
GO:0004674 | protein serine/threonine kinase activity | IBA | -- |
GO:0004712 | protein serine/threonine/tyrosine kinase activity | IEA | -- |
GO:0004713 | protein tyrosine kinase activity | IEA | -- |
GO:0005524 | ATP binding | IEA | -- |
Phenotypes for DSTYK Gene
- GenomeRNAi human phenotypes for DSTYK:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Synthetic lethal with Ras
- Decreased ionizing radiation sensitivity
- Decreased shRNA abundance (Z-score < -2)
- Dynamic nuclei (hole, folded or small irregular)
- Resistant to vaccinia virus (VACV-A4L) infection
- Decreased viability after Maraba virus infection
- Increased G1 DNA content
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased homologous recombination repair frequency
- Increased cilium length after serum starvation
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for DSTYK
-
-
ViGene Biosciences lentiviral particle packaged cDNA for DSTYK gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DSTYK gene
- Search ViGene Biosciences for DSTYK
CRISPR Products
-
OriGene CRISPR knockouts for DSTYK
- genomics-online: gRNA clones - Search results for available DSTYK gene related products
- Applied Biological Materials CRISPR for DSTYK
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DSTYK
- GenScript: Design CRISPR guide RNA sequences for DSTYK
miRNA for DSTYK Gene
- miRTarBase miRNAs that target DSTYK
-
- hsa-mir-122-5p (MIRT003727)
- hsa-mir-130b-3p (MIRT020282)
- hsa-mir-148a-3p (MIRT026003)
- hsa-mir-192-5p (MIRT026422)
- hsa-mir-93-5p (MIRT028170)
- hsa-mir-15a-5p (MIRT051344)
- hsa-mir-130a-3p (MIRT132490)
- hsa-mir-301a-3p (MIRT132492)
- hsa-mir-454-3p (MIRT132502)
- hsa-mir-301b-3p (MIRT132503)
- hsa-mir-4295 (MIRT132505)
- hsa-mir-3666 (MIRT132507)
- hsa-mir-6504-3p (MIRT132511)
- hsa-mir-8080 (MIRT132515)
- hsa-mir-627-3p (MIRT269661)
- hsa-mir-877-3p (MIRT269662)
- hsa-mir-544a (MIRT440769)
- hsa-mir-6878-3p (MIRT523997)
- hsa-mir-6807-5p (MIRT523998)
- hsa-mir-7151-3p (MIRT523999)
- hsa-mir-5095 (MIRT524000)
- hsa-mir-6744-3p (MIRT524001)
- hsa-mir-4757-5p (MIRT524002)
- hsa-mir-661 (MIRT524003)
- hsa-mir-3116 (MIRT524004)
- hsa-mir-1254 (MIRT524005)
- hsa-mir-6781-3p (MIRT524006)
- hsa-mir-2682-3p (MIRT524007)
- hsa-mir-3922-3p (MIRT524008)
- hsa-mir-3176 (MIRT524009)
- hsa-mir-6872-3p (MIRT524010)
- hsa-mir-4438 (MIRT524011)
- hsa-mir-6505-5p (MIRT537907)
- hsa-mir-5192 (MIRT537908)
- hsa-mir-4261 (MIRT537909)
- hsa-mir-875-3p (MIRT537910)
- hsa-mir-665 (MIRT537911)
- hsa-mir-4768-3p (MIRT537912)
- hsa-mir-381-3p (MIRT537913)
- hsa-mir-300 (MIRT537914)
- hsa-mir-6882-5p (MIRT537915)
- hsa-mir-922 (MIRT537916)
- hsa-mir-3678-3p (MIRT537917)
- hsa-mir-4473 (MIRT537918)
- hsa-mir-4671-3p (MIRT537919)
- hsa-mir-2467-3p (MIRT537920)
- hsa-mir-4645-3p (MIRT537921)
- hsa-mir-3919 (MIRT537922)
- hsa-mir-3123 (MIRT537923)
- hsa-mir-30e-3p (MIRT614019)
- hsa-mir-30d-3p (MIRT614020)
- hsa-mir-30a-3p (MIRT614021)
- hsa-mir-1238-3p (MIRT614022)
- hsa-mir-670-3p (MIRT614023)
- hsa-mir-6881-3p (MIRT614024)
- hsa-mir-6780a-3p (MIRT614025)
- hsa-mir-7111-3p (MIRT614026)
- hsa-mir-3127-5p (MIRT615656)
- hsa-mir-3918 (MIRT615657)
- hsa-mir-619-5p (MIRT633006)
- hsa-mir-5004-3p (MIRT633007)
- hsa-mir-1200 (MIRT633008)
- hsa-mir-496 (MIRT633009)
- hsa-mir-432-5p (MIRT633010)
- hsa-mir-544b (MIRT633011)
- hsa-mir-4324 (MIRT633012)
- hsa-mir-5089-5p (MIRT658862)
- hsa-mir-4279 (MIRT658863)
- hsa-mir-675-5p (MIRT658864)
- hsa-mir-4466 (MIRT658865)
- hsa-mir-548q (MIRT658866)
- hsa-mir-6506-5p (MIRT658867)
- hsa-mir-1976 (MIRT658868)
- hsa-mir-150-5p (MIRT658869)
- hsa-mir-6747-3p (MIRT658870)
- hsa-mir-6727-3p (MIRT658871)
- hsa-mir-4722-3p (MIRT658872)
- hsa-mir-6814-5p (MIRT658873)
- hsa-mir-5697 (MIRT658874)
- hsa-mir-562 (MIRT658875)
- hsa-mir-4326 (MIRT717598)
- hsa-mir-498 (MIRT717599)
- hsa-mir-6888-3p (MIRT717600)
- hsa-mir-6783-3p (MIRT717601)
- hsa-mir-1343-3p (MIRT717602)
- hsa-mir-23b-5p (MIRT717603)
- hsa-mir-23a-5p (MIRT717604)
- hsa-mir-3120-5p (MIRT717605)
- hsa-mir-3653-5p (MIRT717606)
- hsa-mir-6742-3p (MIRT717607)
- hsa-mir-6852-5p (MIRT717608)
- hsa-mir-939-3p (MIRT717609)
- hsa-mir-6877-3p (MIRT717610)
- hsa-mir-6819-3p (MIRT717611)
- hsa-mir-5571-5p (MIRT717612)
- hsa-mir-6885-3p (MIRT722510)
- hsa-mir-29b-2-5p (MIRT722511)
- hsa-mir-6839-3p (MIRT722512)
- hsa-mir-4507 (MIRT722513)
- hsa-mir-3940-5p (MIRT722514)
- hsa-mir-19b-2-5p (MIRT722515)
- hsa-mir-19b-1-5p (MIRT722516)
- hsa-mir-19a-5p (MIRT722517)
- hsa-mir-32-5p (MIRT727848)
- hsa-mir-92a-3p (MIRT727849)
- hsa-mir-92b-3p (MIRT727850)
- hsa-mir-106a-3p (MIRT761099)
- hsa-mir-106a-5p (MIRT761121)
- hsa-mir-106b-5p (MIRT761129)
- hsa-mir-1304-3p (MIRT762411)
- hsa-mir-17-5p (MIRT762951)
- hsa-mir-186-3p (MIRT763190)
- hsa-mir-20a-5p (MIRT763758)
- hsa-mir-20b-5p (MIRT763770)
- hsa-mir-302a-3p (MIRT764438)
- hsa-mir-302b-3p (MIRT764459)
- hsa-mir-302c-3p (MIRT764475)
- hsa-mir-302d-3p (MIRT764491)
- hsa-mir-302e (MIRT764507)
- hsa-mir-3622b-5p (MIRT766159)
- hsa-mir-3664-5p (MIRT766501)
- hsa-mir-372-3p (MIRT767236)
- hsa-mir-373-3p (MIRT767279)
- hsa-mir-4639-3p (MIRT770540)
- hsa-mir-4663 (MIRT770812)
- hsa-mir-5186 (MIRT773487)
- hsa-mir-5197-5p (MIRT773661)
- hsa-mir-519d-3p (MIRT773718)
- hsa-mir-520a-3p (MIRT773750)
- hsa-mir-520b (MIRT773770)
- hsa-mir-520c-3p (MIRT773783)
- hsa-mir-520d-3p (MIRT773799)
- hsa-mir-520e (MIRT773815)
- hsa-mir-520g-3p (MIRT773838)
- hsa-mir-520h (MIRT773865)
- hsa-mir-526b-3p (MIRT773914)
- hsa-mir-6794-3p (MIRT779328)
- hsa-mir-7160-5p (MIRT781597)
- hsa-mir-8077 (MIRT782389)
miRNA Products
- Search ViGene Biosciences for DSTYK
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DSTYK
- Browse OriGene Inhibitory RNA Products For DSTYK
- genomics-online: shRNA clones - Search results for available DSTYK gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DSTYK gene
Clone Products
- Sino Biological Human cDNA Clone for DSTYK
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DSTYK
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DSTYK
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DSTYK
- genomics-online: cdna clones - Search results for available DSTYK gene related products
- orf clones - Search results for available DSTYK gene related products
- Applied Biological Materials Clones for DSTYK
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for DSTYK
-
ViGene Biosciences adenoviral particle packaged cDNA for DSTYK gene
-
ViGene Biosciences lentiviral particle packaged cDNA for DSTYK gene
-
ViGene Biosciences ready-to-package AAV shRNAs for DSTYK gene
No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for DSTYK Gene
Localization for DSTYK Gene
Subcellular locations from UniProtKB/Swiss-Prot for DSTYK Gene
- Cytoplasm. Cell membrane. Apical cell membrane. Basolateral cell membrane. Cell junction. Note=Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane (By similarity). Detected in basolateral and apical membranes of all tubular epithelia. {ECO:0000250 UniProtKB:Q6XUX1, ECO:0000269 PubMed:23862974}.
- Intermediate filaments (1)
- Nuclear speckles (1)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005737 | cytoplasm | IEA,IDA | 23862974 |
GO:0005829 | cytosol | IBA | -- |
GO:0005886 | plasma membrane | IEA | -- |
GO:0016020 | membrane | IEA | -- |
GO:0016323 | basolateral plasma membrane | IDA,IEA | 23862974 |
Pathways & Interactions for DSTYK Gene
Interacting Proteins for DSTYK Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006468 | protein phosphorylation | IEA | -- |
GO:0016310 | phosphorylation | IEA | -- |
GO:0018108 | peptidyl-tyrosine phosphorylation | IEA | -- |
GO:0033674 | positive regulation of kinase activity | IMP | 23862974 |
GO:0043066 | negative regulation of apoptotic process | IMP | 28157540 |
No data available for Pathways by source and SIGNOR curated interactions for DSTYK Gene
Drugs & Compounds for DSTYK Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
ATP | Investigational | Nutra | Agonist | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for DSTYK Gene
mRNA/cDNA for DSTYK Gene
- (5) REFSEQ mRNAs :
- (13) Additional mRNA sequences :
- (192) Selected AceView cDNA sequences:
- (3) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for DSTYK Gene
CRISPR Products
-
OriGene CRISPR knockouts for DSTYK
- genomics-online: gRNA clones - Search results for available DSTYK gene related products
- Applied Biological Materials CRISPR for DSTYK
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for DSTYK
- GenScript: Design CRISPR guide RNA sequences for DSTYK
miRNA Products
- Search ViGene Biosciences for DSTYK
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DSTYK
- Browse OriGene Inhibitory RNA Products For DSTYK
- genomics-online: shRNA clones - Search results for available DSTYK gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for DSTYK gene
Clone Products
- Sino Biological Human cDNA Clone for DSTYK
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for DSTYK
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DSTYK
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DSTYK
- genomics-online: cdna clones - Search results for available DSTYK gene related products
- orf clones - Search results for available DSTYK gene related products
- Applied Biological Materials Clones for DSTYK
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10 | ^ | 11a | · | 11b | ^ | 12 | ^ | 13a | · | 13b |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | ||||||||||||||||||||||||||||||||||||
SP2: | - | - | |||||||||||||||||||||||||||||||||||
SP3: | |||||||||||||||||||||||||||||||||||||
SP4: | - | - | - | - | - | - | - | - |
Expression for DSTYK Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Blood (Hematopoietic System)
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DSTYK Gene
NURSA nuclear receptor signaling pathways regulating expression of DSTYK Gene:
DSTYKSOURCE GeneReport for Unigene cluster for DSTYK Gene:
Hs.6874mRNA Expression by UniProt/SwissProt for DSTYK Gene:
Q6XUX3-DUSTY_HUMANEvidence on tissue expression from TISSUES for DSTYK Gene
- Nervous system(4.6)
- Skin(4.4)
- Eye(4.3)
- Lymph node(4.2)
- Muscle(4.2)
- Spleen(4.2)
- Blood(4)
Phenotype-based relationships between genes and organs from Gene ORGANizer for DSTYK Gene
- endoderm
- mesoderm
- urinary
- kidney
- ureter
- urinary bladder
Primer Products
-
OriGene qPCR primer pairs and template standards for DSTYK
-
OriGene qPCR primer pairs for DSTYK
- genomics-online: primer clones - Search results for available DSTYK gene related products
No data available for mRNA differential expression in normal tissues and Protein tissue co-expression partners for DSTYK Gene
Orthologs for DSTYK Gene
This gene was present in the common ancestor of animals and fungi.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | DSTYK 33 34 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | -- 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
cow (Bos Taurus) |
Mammalia | DSTYK 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | DSTYK 33 34 |
|
||
mouse (Mus musculus) |
Mammalia | Dstyk 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Dstyk 33 |
|
||
chicken (Gallus gallus) |
Aves | DSTYK 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | DSTYK 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | dstyk 33 |
|
||
African clawed frog (Xenopus laevis) |
Amphibia | Xl.5447 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | dstyk 33 34 |
|
||
Dr.13169 33 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | png 34 |
|
ManyToMany | |
Wsck 34 |
|
ManyToMany | |||
worm (Caenorhabditis elegans) |
Secernentea | Y47G6A.5 34 |
|
ManyToMany | |
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | CDC15 34 |
|
OneToMany |
- Species where no ortholog for DSTYK was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- oppossum (Monodelphis domestica)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for DSTYK Gene
(1) SIMAP similar genes for DSTYK Gene using alignment to 2 proteins:
No data available for Paralogs for DSTYK Gene
Variants for DSTYK Gene
SNP ID | Clin | Chr 01 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs148815814 | uncertain-significance, Congenital anomalies of kidney and urinary tract 1, susceptibility to | 205,162,079(-) | C/T | coding_sequence_variant, missense_variant | |
rs200780796 | pathogenic, Congenital anomalies of kidney and urinary tract 1, susceptibility to, Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805] | 205,211,450(-) | C/T | coding_sequence_variant, genic_upstream_transcript_variant, missense_variant, upstream_transcript_variant | |
rs201091809 | uncertain-significance, Congenital anomalies of kidney and urinary tract 1, susceptibility to | 205,187,417(-) | C/T | intron_variant, splice_donor_variant | |
rs202068245 | uncertain-significance, Congenital anomalies of kidney and urinary tract 1, susceptibility to | 205,211,483(-) | G/A | coding_sequence_variant, genic_upstream_transcript_variant, missense_variant, upstream_transcript_variant | |
rs367692056 | uncertain-significance, Congenital anomalies of kidney and urinary tract 1, susceptibility to | 205,161,390(-) | G/A | intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv563n100 | CNV | gain | 25217958 |
esv1503810 | OTHER | inversion | 17803354 |
esv2721906 | CNV | deletion | 23290073 |
esv2721918 | CNV | deletion | 23290073 |
esv3414627 | CNV | insertion | 20981092 |
esv3588631 | OTHER | inversion | 21293372 |
esv7237 | OTHER | inversion | 19470904 |
nsv1079018 | OTHER | inversion | 25765185 |
nsv1141904 | OTHER | inversion | 24896259 |
nsv468016 | CNV | loss | 19166990 |
nsv549042 | CNV | loss | 21841781 |
nsv946605 | CNV | duplication | 23825009 |
Additional Variant Information for DSTYK Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DSTYK Gene
Disorders for DSTYK Gene

(6) MalaCards diseases for DSTYK Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, and GeneCards
Disorder | Aliases | PubMed IDs |
---|---|---|
congenital anomalies of kidney and urinary tract 1 |
|
|
spastic paraplegia 23 |
|
|
renal agenesis, unilateral |
|
|
posterior urethral valves |
|
|
anus, imperforate |
|
|
UniProtKB/Swiss-Prot
DUSTY_HUMAN- Congenital anomalies of the kidney and urinary tract 1 (CAKUT1) [MIM:610805]: A disorder encompassing a broad spectrum of renal and urinary tract malformations that include renal agenesis, kidney hypodysplasia, multicystic kidney dysplasia, duplex collecting system, posterior urethral valves and ureter abnormalities. Congenital anomalies of kidney and urinary tract are the commonest cause of chronic kidney disease in children. {ECO:0000269 PubMed:23862974}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
- Spastic paraplegia 23 (SPG23) [MIM:270750]: A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. SPG23 is an autosomal recessive form characterized by childhood-onset of gait difficulties and pigmentary abnormalities, including premature graying of the hair and vitiligo-like or hyperpigmented skin lesions. {ECO:0000269 PubMed:28157540}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for DSTYK
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for DSTYK Gene
Publications for DSTYK Gene
- RIP5 is a RIP-homologous inducer of cell death. (PMID: 15178406) Zha J … Shu HB (Biochemical and biophysical research communications 2004) 2 3 4 58
- Large Intragenic Deletion in DSTYK Underlies Autosomal-Recessive Complicated Spastic Paraparesis, SPG23. (PMID: 28157540) Lee JYW … McGrath JA (American journal of human genetics 2017) 3 4 58
- Mutations in DSTYK and dominant urinary tract malformations. (PMID: 23862974) Sanna-Cherchi S … Gharavi AG (The New England journal of medicine 2013) 3 4 58
- Dusty protein kinases: primary structure, gene evolution, tissue specific expression and unique features of the catalytic domain. (PMID: 17123648) Peng J … Huang CH (Biochimica et biophysica acta 2006) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
Products for DSTYK Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for DSTYK
- Search Origene for MassSpec and Protein Over-expression Lysates for DSTYK
- Origene Custom Protein Services for DSTYK
- Origene shrna, sirna, and RNAi products in human, mouse, rat for DSTYK
- Browse OriGene Inhibitory RNA Products For DSTYK
- OriGene qPCR primer pairs and template standards for DSTYK
- OriGene qPCR primer pairs for DSTYK
- OriGene CRISPR knockouts for DSTYK
- OriGene ORF clones in human for DSTYK
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For DSTYK
- GenScript: Next-day shipping of latest version cDNA ORF clones for DSTYK in any vector
- GenScript Custom Purified and Recombinant Proteins Services for DSTYK
- GenScript Custom Assay Services for DSTYK
- GenScript Custom overexpressing Cell Line Services for DSTYK
- GenScript: Design CRISPR guide RNA sequences for DSTYK
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for DSTYK
- Sino Biological Human cDNA Clone for DSTYK
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for DSTYK
- Novus Biologicals lysates and proteins for DSTYK
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam proteins for DSTYK
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for DSTYK
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for DSTYK
- VectorBuilder custom plasmid, inducible vectors for DSTYK
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for DSTYK
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for DSTYK
- antibodies-online: Search results for available DSTYK related products ranked by validation data
- antibodies-online: Search results for available DSTYK related products ranked by validation data
- antibodies-online: Search results for available DSTYK related products ranked by validation data
- GeneTex DSTYK antibody for DSTYK
- Search GeneTex for Proteins for DSTYK
- ViGene Biosciences adenoviral particle packaged cDNA for DSTYK gene
- ViGene Biosciences lentiviral particle packaged cDNA for DSTYK gene
- ViGene Biosciences ready-to-package AAV shRNAs for DSTYK gene
- Search ViGene Biosciences for DSTYK
- Santa Cruz Biotechnology (SCBT) Antibodies for DSTYK
- Search Santa Cruz Biotechnology (SCBT) for DSTYK siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for DSTYK
- Horizon Cell Lines for DSTYK
- genomics-online: cdna clones - Search results for available DSTYK gene related products
- orf clones - Search results for available DSTYK gene related products
- genomics-online: gRNA clones - Search results for available DSTYK gene related products
- genomics-online: primer clones - Search results for available DSTYK gene related products
- genomics-online: shRNA clones - Search results for available DSTYK gene related products
Sources for DSTYK Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew