Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DLST Gene

Aliases for DLST Gene

  • Dihydrolipoamide S-Succinyltransferase 2 3 5
  • Dihydrolipoamide S-Succinyltransferase (E2 Component Of 2-Oxo-Glutarate Complex) 2 3
  • EC 2.3.1.61 4 61
  • OGDC-E2 3 4
  • DLTS 3 4
  • E2K 3 4
  • Dihydrolipoyllysine-Residue Succinyltransferase Component Of 2-Oxoglutarate Dehydrogenase Complex, Mitochondrial 3
  • Dihydrolipoamide Succinyltransferase Component Of 2-Oxoglutarate Dehydrogenase Complex 4
  • 2-Oxoglutarate Dehydrogenase Complex Component E2 4
  • Dihydrolipoyllysine-Residue Succinyltransferase 2
  • EC 2.3.1 61

External Ids for DLST Gene

Previous HGNC Symbols for DLST Gene

  • DLTS

Previous GeneCards Identifiers for DLST Gene

  • GC14P072875
  • GC14P069166
  • GC14P073338
  • GC14P074418
  • GC14P075348
  • GC14P055516

Summaries for DLST Gene

Entrez Gene Summary for DLST Gene

  • This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]

GeneCards Summary for DLST Gene

DLST (Dihydrolipoamide S-Succinyltransferase) is a Protein Coding gene. Diseases associated with DLST include Alpha-Ketoglutarate Dehydrogenase Deficiency and Wernicke-Korsakoff Syndrome. Among its related pathways are Citrate cycle (TCA cycle) and Lysine degradation. GO annotations related to this gene include transferase activity and dihydrolipoyllysine-residue succinyltransferase activity. An important paralog of this gene is DBT.

UniProtKB/Swiss-Prot for DLST Gene

  • The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Gene Wiki entry for DLST Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DLST Gene

Genomics for DLST Gene

Regulatory Elements for DLST Gene

Enhancers for DLST Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH14G074880 1.4 Ensembl ENCODE 39.5 +2.3 2273 6.5 PKNOX1 MLX ARID4B SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZNF143 ZNF207 DLST RPS6KL1 ENSG00000258559 PGF PROX2 ENSG00000270140 RNU6-689P PIR36863
GH14G074840 1.2 Ensembl ENCODE 43.1 -40.5 -40463 2.3 ELF3 PKNOX1 ARID4B SIN3A ZNF48 RAD21 YY1 ZNF143 RELB ETV6 DLST RPS6KL1 PROX2 LTBP2 MLH3 ZC2HC1C FCF1 ENSG00000222604 LOC105370569 GC14M074853
GH14G074834 1.2 Ensembl ENCODE 43 -44.7 -44723 5.0 FOXA2 ARNT ARID4B TCF12 ZNF143 FOS NCOA1 REST TBX21 ZNF592 DLST PROX2 LTBP2 MLH3 ZC2HC1C FCF1 ENSG00000222604 LOC105370569 GC14P074822
GH14G074938 1.7 FANTOM5 Ensembl ENCODE dbSUPER 28.9 +59.2 59211 4.6 HDGF ZBTB40 GLIS2 GATA2 ZNF143 ZNF207 FOS RELB ETV6 IKZF2 DLST ACYP1 ZC2HC1C EIF2B2 RNU6-689P MLH3 RPS6KL1 GC14P074952
GH14G074915 0.9 Ensembl ENCODE 40.3 +35.1 35093 3.1 NFIC POLR2A ZNF544 SMARCA4 NFIB HLF NR3C1 TBX21 DLST RPS6KL1 PGF PROX2 ENSG00000258646 EIF2B2 ZC2HC1C ACYP1 MLH3 RNU6-689P
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DLST on UCSC Golden Path with GeneCards custom track

Promoters for DLST Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000070805 509 2001 PKNOX1 MLX ARID4B SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZNF143 ZNF207

Genomic Location for DLST Gene

Chromosome:
14
Start:
74,881,891 bp from pter
End:
74,903,747 bp from pter
Size:
21,857 bases
Orientation:
Plus strand

Genomic View for DLST Gene

Genes around DLST on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DLST Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DLST Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DLST Gene

Proteins for DLST Gene

  • Protein details for DLST Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P36957-ODO2_HUMAN
    Recommended name:
    Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
    Protein Accession:
    P36957
    Secondary Accessions:
    • B7Z5W8
    • E7ESY5
    • Q7LDY7
    • Q9BQ32

    Protein attributes for DLST Gene

    Size:
    453 amino acids
    Molecular mass:
    48755 Da
    Cofactor:
    Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088;
    Quaternary structure:
    • Forms a 24-polypeptide structural core with octahedral symmetry.

    Alternative splice isoforms for DLST Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DLST Gene

Selected DME Specific Peptides for DLST Gene

P36957:
  • SRAFSRSLSAFQKGNCPL
  • TPIINPPQS
  • GLVVPVIR
  • AFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDD
  • YDHRLIDG
  • TPAFAESVTEGDVRWEKAVGD
  • AMLTTFNE
  • DGREAVTFLRKIKAAVEDPR
  • VPVIRNV
  • GTFTISN
  • RPMMYVALTYDHRL
  • NGGVFGSL
  • LLVPDGGKVEGGTPLF
  • TKEVVYRDYIDISVAVATPRGLVVPVIRNVE
  • LTTFNEIDM
  • SVAVATP
  • EDEVVCEIETDKTSVQVPSPA

Post-translational modifications for DLST Gene

  • Ubiquitination at isoforms=2203 and isoforms=2217
  • Modification sites at PhosphoSitePlus

Domains & Families for DLST Gene

Graphical View of Domain Structure for InterPro Entry

P36957

UniProtKB/Swiss-Prot:

ODO2_HUMAN :
  • Belongs to the 2-oxoacid dehydrogenase family.
Family:
  • Belongs to the 2-oxoacid dehydrogenase family.
genes like me logo Genes that share domains with DLST: view

No data available for Gene Families for DLST Gene

Function for DLST Gene

Molecular function for DLST Gene

GENATLAS Biochemistry:
dihydrolipoamide S-succinyltransferase
UniProtKB/Swiss-Prot CatalyticActivity:
Succinyl-CoA + enzyme N(6)-(dihydrolipoyl)lysine = CoA + enzyme N(6)-(S-succinyldihydrolipoyl)lysine.
UniProtKB/Swiss-Prot Function:
The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Enzyme Numbers (IUBMB) for DLST Gene

Gene Ontology (GO) - Molecular Function for DLST Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004149 dihydrolipoyllysine-residue succinyltransferase activity IEA --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with DLST: view
genes like me logo Genes that share phenotypes with DLST: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for DLST Gene

Localization for DLST Gene

Subcellular locations from UniProtKB/Swiss-Prot for DLST Gene

Mitochondrion.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DLST gene
Compartment Confidence
extracellular 5
mitochondrion 5
nucleus 5
cytosol 3

Gene Ontology (GO) - Cellular Components for DLST Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA 21630459
GO:0005739 mitochondrion IDA --
GO:0005759 mitochondrial matrix TAS --
GO:0016020 membrane IDA 19946888
GO:0043209 myelin sheath IEA --
genes like me logo Genes that share ontologies with DLST: view

Pathways & Interactions for DLST Gene

genes like me logo Genes that share pathways with DLST: view

UniProtKB/Swiss-Prot P36957-ODO2_HUMAN

  • Pathway: Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6.

Gene Ontology (GO) - Biological Process for DLST Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006091 generation of precursor metabolites and energy TAS 8009371
GO:0006099 tricarboxylic acid cycle TAS --
GO:0006554 lysine catabolic process TAS --
GO:0008152 metabolic process IEA --
GO:0033512 L-lysine catabolic process to acetyl-CoA via saccharopine IEA --
genes like me logo Genes that share ontologies with DLST: view

No data available for SIGNOR curated interactions for DLST Gene

Drugs & Compounds for DLST Gene

(3) Drugs for DLST Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Succinyl-CoA Experimental Pharma 0
Coenzyme A Nutra 0

(6) Additional Compounds for DLST Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Dihydrolipoamide
  • 6,8-Bis-sulfanyloctanamide
  • 6,8-Dimercapto-Octanamide
  • 6,8-Dimercaptooctanamide
  • 6,8-Disulfanyloctanamide
  • Dihydrolipoamide
3884-47-7
(R)-lipoic acid
  • (+)-alpha-Lipoic acid
  • (R)-(+)-lipoic acid
  • (R)-1,2-Dithiolane-3-pentanoic acid
  • (R)-1,2-dithiolane-3-valeric acid
  • (R)-6,8-thioctic acid
1200-22-2
(S)-Succinyldihydrolipoamide
  • S-Succinyl-dihydrolipoamide
  • S-Succinyldihydrolipoamide
Glutaryl-coa
  • Glutaryl-CoA
  • Glutaryl-coenzyme A
103192-48-9
S-Glutaryldihydrolipoamide
genes like me logo Genes that share compounds with DLST: view

Transcripts for DLST Gene

Unigene Clusters for DLST Gene

Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for DLST Gene

No ASD Table

Relevant External Links for DLST Gene

GeneLoc Exon Structure for
DLST
ECgene alternative splicing isoforms for
DLST

Expression for DLST Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DLST Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for DLST Gene

This gene is overexpressed in Heart (7.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DLST Gene



Protein tissue co-expression partners for DLST Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DLST Gene:

DLST

SOURCE GeneReport for Unigene cluster for DLST Gene:

Hs.525459

Evidence on tissue expression from TISSUES for DLST Gene

  • Nervous system(4.7)
  • Liver(4.4)
  • Lung(4.4)
  • Blood(4.2)
  • Heart(2.4)
  • Kidney(2.4)
  • Muscle(2)
genes like me logo Genes that share expression patterns with DLST: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DLST Gene

Orthologs for DLST Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DLST Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DLST 34 35
  • 99.48 (n)
dog
(Canis familiaris)
Mammalia DLST 34 35
  • 92.94 (n)
cow
(Bos Taurus)
Mammalia DLST 34 35
  • 91.61 (n)
oppossum
(Monodelphis domestica)
Mammalia DLST 35
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Dlst 34 16 35
  • 88.52 (n)
rat
(Rattus norvegicus)
Mammalia Dlst 34
  • 88.15 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 85 (a)
OneToMany
-- 35
  • 55 (a)
OneToMany
chicken
(Gallus gallus)
Aves DLST 34 35
  • 75.85 (n)
lizard
(Anolis carolinensis)
Reptilia DLST 35
  • 72 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dlst 34
  • 70.16 (n)
Str.124 34
African clawed frog
(Xenopus laevis)
Amphibia dlst-prov 34
zebrafish
(Danio rerio)
Actinopterygii dlst 34 35
  • 70.05 (n)
Dr.3786 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9840 34
fruit fly
(Drosophila melanogaster)
Insecta CG5214 36 35
  • 72 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP004055 34
  • 66.95 (n)
worm
(Caenorhabditis elegans)
Secernentea W02F12.5 36
  • 67 (a)
dlst-1 34 35
  • 64.1 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL200W 34
  • 61.16 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0D16522g 34
  • 58.7 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KGD2 34 35 37
  • 57.3 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT5G55070 34
  • 54.69 (n)
soybean
(Glycine max)
eudicotyledons Gma.6351 34
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.7649 34
rice
(Oryza sativa)
Liliopsida Os04g0394200 34
  • 64.35 (n)
Os.8748 34
barley
(Hordeum vulgare)
Liliopsida Hv.2268 34
wheat
(Triticum aestivum)
Liliopsida Ta.28698 34
corn
(Zea mays)
Liliopsida Zm.1058 34
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes kgd2 34
  • 57.9 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.8110 35
  • 56 (a)
OneToOne
bread mold
(Neurospora crassa)
Ascomycetes NCU02438 34
  • 53.27 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.6748 34
Species where no ortholog for DLST was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for DLST Gene

ENSEMBL:
Gene Tree for DLST (if available)
TreeFam:
Gene Tree for DLST (if available)

Paralogs for DLST Gene

Paralogs for DLST Gene

Pseudogenes.org Pseudogenes for DLST Gene

genes like me logo Genes that share paralogs with DLST: view

Variants for DLST Gene

Sequence variations from dbSNP and Humsavar for DLST Gene

SNP ID Clin Chr 14 pos Sequence Context AA Info Type
rs1000200089 -- 74,901,591(+) CATGT(C/T)AGTCT intron-variant, downstream-variant-500B
rs1000308785 -- 74,900,937(+) CCCAG(A/G)TTGGC intron-variant
rs1000495709 -- 74,888,429(+) AATCT(A/G)TCTCG intron-variant
rs1000534368 -- 74,899,830(+) CAAGC(C/T)CTGCA intron-variant
rs1000870141 -- 74,882,304(+) GACTC(-/AG)AGTTA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for DLST Gene

Variant ID Type Subtype PubMed ID
nsv832832 CNV gain+loss 17160897
nsv977487 CNV duplication 23825009

Variation tolerance for DLST Gene

Residual Variation Intolerance Score: 13.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.20; 52.11% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DLST Gene

Human Gene Mutation Database (HGMD)
DLST
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DLST

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DLST Gene

Disorders for DLST Gene

MalaCards: The human disease database

(3) MalaCards diseases for DLST Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
alpha-ketoglutarate dehydrogenase deficiency
  • 2 alpha ketoglutarate dehydrogenase deficiency
wernicke-korsakoff syndrome
  • korsakoff syndrome
alzheimer disease
  • alzheimer disease, late-onset
- elite association - COSMIC cancer census association via MalaCards
Search DLST in MalaCards View complete list of genes associated with diseases

Relevant External Links for DLST

Genetic Association Database (GAD)
DLST
Human Genome Epidemiology (HuGE) Navigator
DLST
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DLST
genes like me logo Genes that share disorders with DLST: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DLST Gene

Publications for DLST Gene

  1. [Association between DLST gene polymorphism and Alzheimer's disease]. (PMID: 11825528) Ma Q. … Yang J. (Zhonghua Yi Xue Za Zhi 2001) 3 22 46 64
  2. Lack of replication of association findings in complex disease: an analysis of 15 polymorphisms in prior candidate genes for sporadic Alzheimer's disease. (PMID: 11436125) Prince J.A. … Brookes A.J. (Eur. J. Hum. Genet. 2001) 3 22 46 64
  3. No association between DLST gene and Alzheimer's disease or Wernicke-Korsakoff syndrome. (PMID: 11445257) Matsushita S. … Higuchi S. (Neurobiol. Aging 2001) 3 22 46 64
  4. Isolation, characterization, and mapping of gene encoding dihydrolipoyl succinyltransferase (E2k) of human alpha-ketoglutarate dehydrogenase complex. (PMID: 8009371) Ali G. … Blass J.P. (Somat. Cell Mol. Genet. 1994) 2 3 22 64
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64

Products for DLST Gene

Sources for DLST Gene

Content
Loading form....