Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DHX9 Gene

Aliases for DHX9 Gene

  • DExH-Box Helicase 9 2 3 5
  • Nuclear DNA Helicase II 2 3 4
  • Leukophysin 2 3 4
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9 2 3
  • DEAH (Asp-Glu-Ala-His) Box Helicase 9 2 3
  • DEAH Box Protein 9 3 4
  • RNA Helicase A 2 3
  • NDH II 2 4
  • DDX9 3 4
  • NDH2 3 4
  • LKP 3 4
  • RHA 3 4
  • DEAH (Asp-Glu-Ala-His) Box Polypeptide 9 3
  • ATP-Dependent RNA Helicase A 3
  • DEAH-Box Helicase 9 3
  • EC 3.6.1.15 58
  • EC 3.6.4.13 4
  • EC 3.6.1 58
  • NDHII 3

External Ids for DHX9 Gene

Previous HGNC Symbols for DHX9 Gene

  • LKP
  • DDX9

Previous GeneCards Identifiers for DHX9 Gene

  • GC01P179328
  • GC01P180047
  • GC01P180029
  • GC01P179540
  • GC01P181075
  • GC01P182808
  • GC01P154044

Summaries for DHX9 Gene

Entrez Gene Summary for DHX9 Gene

  • This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]

GeneCards Summary for DHX9 Gene

DHX9 (DExH-Box Helicase 9) is a Protein Coding gene. Diseases associated with DHX9 include Pseudopterygium and Werner Syndrome. Among its related pathways are Activated TLR4 signalling and mRNA Splicing - Major Pathway. GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is DHX57.

UniProtKB/Swiss-Prot for DHX9 Gene

  • Unwinds double-stranded DNA and RNA in a 3 to 5 direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms. Positively regulates HIV-1 LTR-directed gene expression.

Gene Wiki entry for DHX9 Gene

Additional gene information for DHX9 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DHX9 Gene

Genomics for DHX9 Gene

Regulatory Elements for DHX9 Gene

Enhancers for DHX9 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01H183469 1.5 ENCODE dbSUPER 199.9 +632.5 632505 4 MLX FEZF1 DMAP1 YY1 ZNF416 ZNF143 ZNF548 SP3 NFYC ZC3H11A DHX9 LAMC1-AS1 HMGN1P4 SMG7 LAMC1 SMG7-AS1 ENSG00000227554 KRT18P28 LOC100271717 RNA5SP71
GH01H182388 1.4 ENCODE dbSUPER 90.7 -448.5 -448465 5 HDGF FOXA2 ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 CBX5 DHX9 HMGN1P4 LAMC1-AS1 RNASEL TEDDM2P RPL18P2 ENSG00000232309 LINC01688 RNA5SP71 KRT18P28
GH01H183043 1.4 Ensembl ENCODE dbSUPER 56.9 +205.2 205225 2 PKNOX1 FOXA2 NFIB INSM2 ZNF195 FEZF1 RAD21 YY1 ZSCAN5C SCRT2 DHX9 LAMC1-AS1 LAMC1
GH01H182600 1.6 Ensembl ENCODE dbSUPER 33.7 -236.3 -236324 4 HDGF PKNOX1 SIN3A FEZF1 ZNF2 YY1 ZNF143 SP3 REST SMARCB1 DHX9 RNASEL LAMC1-AS1 HMGN1P4 LINC01688 TEDDM2P RPL18P2 KRT18P28 LOC100271717 RNA5SP71
GH01H182299 1.9 FANTOM5 Ensembl ENCODE dbSUPER 27.6 -538.3 -538313 3 HDGF PKNOX1 FOXA2 MLX ARNT ARID4B YBX1 FEZF1 DMAP1 ZNF766 DHX9 HMGN1P4 LAMC1 GLUL RPL18P2 RNU6-152P EIF1P3 LINC01344 YPEL5P1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DHX9 on UCSC Golden Path with GeneCards custom track

Promoters for DHX9 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000016761 596 1801 HNRNPUL1 HDGF MLX ARNT ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2

Genomic Location for DHX9 Gene

Chromosome:
1
Start:
182,839,304 bp from pter
End:
182,887,982 bp from pter
Size:
48,679 bases
Orientation:
Plus strand

Genomic View for DHX9 Gene

Genes around DHX9 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DHX9 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DHX9 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DHX9 Gene

Proteins for DHX9 Gene

  • Protein details for DHX9 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q08211-DHX9_HUMAN
    Recommended name:
    ATP-dependent RNA helicase A
    Protein Accession:
    Q08211
    Secondary Accessions:
    • B2RNV4
    • Q05CI5
    • Q12803
    • Q32Q22
    • Q5VY62
    • Q6PD69
    • Q99556

    Protein attributes for DHX9 Gene

    Size:
    1270 amino acids
    Molecular mass:
    140958 Da
    Quaternary structure:
    • Interacts with ZIC2, IGF2BP1, IGF2BP2, IGF2BP3, MBD2, HRMT1L2/PRMT1, RELA and LARP6. Can also interact with XRCC5 and with TOP2A in an RNA dependent manner; these interactions may be indirect. Interaction with TOP2A is promoted by UBC9. Interacts with histone H2AFX and this requires phosphorylation of H2AFX on Ser-139. Interacts (via N-terminus) with EIF2AK2/PKR and this interaction is dependent upon the activation of the kinase. Component of the coding region determinant (CRD)-mediated complex, composed of DHX9, HNRNPU, IGF2BP1, SYNCRIP and YBX1. May act to directly link BRCA1, CREBBP or SMN1 and the RNA polymerase II complex. Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1. Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active).

    Three dimensional structures from OCA and Proteopedia for DHX9 Gene

    Alternative splice isoforms for DHX9 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DHX9 Gene

Selected DME Specific Peptides for DHX9 Gene

Q08211:
  • SCALSLVRQL
  • GMGNSTNKKDAQ
  • FEPSQRQN
  • EKIRTRAISAKGMT
  • IVVTQPR
  • RDFVNYLVR
  • GDGPRPPKMAR
  • PLQLLLFASKKV
  • AYPEVRIVLMSATIDT
  • GGPLPPHL
  • MQKHLEMNPHFGSH
  • DVVYVID
  • PFFVFGEKIRTRA
  • GCIFYVGDA
  • AERVAFER
  • RGANLKDYY
  • LPVKKFE
  • ILSTNIAE
  • ATVWASKTN
  • AETSITI
  • FRTPLHE
  • KNFLYAWCGK
  • NDELTPLGRILAKLPIEPR
  • RFCEHKRLNMATLRMTWEAKVQLK
  • AATCFPEPFI
  • GVLLRKL
  • KYPSPFFVF
  • IVDEIHE
  • QVGPDHNRSFIAEMT
  • LPRPHAS
  • NTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRN
  • ALSIKLLRLGGIG
  • TNIAETS
  • EQISMDLKNEL
  • GEEAEIRFCE
  • TQPRRISA
  • QLNEKETPFELIEALL
  • SQLDPVNE
  • QATLESEEVDLNAGLHGNWTLENAKARLNQ
  • YSGLTKKKEGE
  • VVIIRGATGCGKTTQVPQ
  • GIRGISHVIVDEIHERDINTDFLLVVLRDV
  • LEDCIQMT
  • AREHGSNKKLAAQSCALS
  • GVVPWSPPQ
  • EQRKVFDPVP

Post-translational modifications for DHX9 Gene

  • May be phosphorylated by PRKDC/XRCC7. Phosphorylated by EIF2AK2/PKR and this phosphorylation perturbs its association with dsRNA.
  • Methylated. HRMT1L2 mediated methylation of undefined Arg residues in the NTD is required for nuclear localization.
  • Ubiquitination at isoforms=191, isoforms=417, isoforms=857, posLast=10371037, and isoforms=21048
  • Modification sites at PhosphoSitePlus

Other Protein References for DHX9 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for DHX9 Gene

Gene Families for DHX9 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for DHX9 Gene

Graphical View of Domain Structure for InterPro Entry

Q08211

UniProtKB/Swiss-Prot:

DHX9_HUMAN :
  • The MTAD domain mediates interaction with the RNA polymerase II holoenzyme. The NTD domain is necessary and sufficient for nucleo-cytoplasmic shuttling and interaction with HRMT1L2 and SMN1.
  • Belongs to the DEAD box helicase family. DEAH subfamily.
Domain:
  • The MTAD domain mediates interaction with the RNA polymerase II holoenzyme. The NTD domain is necessary and sufficient for nucleo-cytoplasmic shuttling and interaction with HRMT1L2 and SMN1.
Family:
  • Belongs to the DEAD box helicase family. DEAH subfamily.
genes like me logo Genes that share domains with DHX9: view

Function for DHX9 Gene

Molecular function for DHX9 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
Unwinds double-stranded DNA and RNA in a 3 to 5 direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms. Positively regulates HIV-1 LTR-directed gene expression.

Enzyme Numbers (IUBMB) for DHX9 Gene

Gene Ontology (GO) - Molecular Function for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000993 RNA polymerase II core binding IDA 11416126
GO:0001047 core promoter binding IDA 11038348
GO:0001069 regulatory region RNA binding IDA 28355180
GO:0001085 RNA polymerase II transcription factor binding IPI 17303075
GO:0001104 RNA polymerase II transcription cofactor activity IMP 11416126
genes like me logo Genes that share ontologies with DHX9: view
genes like me logo Genes that share phenotypes with DHX9: view

Animal Models for DHX9 Gene

MGI Knock Outs for DHX9:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for DHX9
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DHX9 Gene

Localization for DHX9 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DHX9 Gene

Nucleus, nucleolus. Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Can shuttle between nucleus and cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DHX9 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 5
mitochondrion 2
plasma membrane 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,TAS 9162007
GO:0005654 nucleoplasm TAS --
GO:0005726 perichromatin fibrils IDA 10198287
GO:0005730 nucleolus IDA,IEA --
GO:0005737 cytoplasm TAS,IDA 9162007
genes like me logo Genes that share ontologies with DHX9: view

Pathways & Interactions for DHX9 Gene

genes like me logo Genes that share pathways with DHX9: view

Gene Ontology (GO) - Biological Process for DHX9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000380 alternative mRNA splicing, via spliceosome IMP 28221134
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0001649 osteoblast differentiation IDA 16210410
GO:0006260 DNA replication IEA --
GO:0006353 DNA-templated transcription, termination IEA --
genes like me logo Genes that share ontologies with DHX9: view

No data available for SIGNOR curated interactions for DHX9 Gene

Drugs & Compounds for DHX9 Gene

(5) Drugs for DHX9 Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
ATP Nutra Agonist 0
YK-4-279 Pharma RNA Helicase A (RHA) inhibitor 0

(2) Additional Compounds for DHX9 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for DHX9 Gene

Compound Action Cas Number
YK-4-279 RNA Helicase A (RHA) inhibitor 1037184-44-3
genes like me logo Genes that share compounds with DHX9: view

Drug Products

Transcripts for DHX9 Gene

Unigene Clusters for DHX9 Gene

DEAH (Asp-Glu-Ala-His) box polypeptide 9:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for DHX9
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for DHX9 Gene

No ASD Table

Relevant External Links for DHX9 Gene

GeneLoc Exon Structure for
DHX9
ECgene alternative splicing isoforms for
DHX9

Expression for DHX9 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DHX9 Gene

Protein differential expression in normal tissues from HIPED for DHX9 Gene

This gene is overexpressed in Tlymphocyte (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DHX9 Gene



Protein tissue co-expression partners for DHX9 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DHX9 Gene:

DHX9

SOURCE GeneReport for Unigene cluster for DHX9 Gene:

Hs.191518

Evidence on tissue expression from TISSUES for DHX9 Gene

  • Nervous system(5)
  • Liver(4.6)
  • Muscle(4.2)
  • Eye(3.5)
  • Heart(3.4)
  • Lung(3.1)
  • Skin(3)
  • Kidney(2.9)
  • Intestine(2.7)
  • Adrenal gland(2.6)
  • Pancreas(2.5)
  • Spleen(2)
genes like me logo Genes that share expression patterns with DHX9: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DHX9 Gene

Orthologs for DHX9 Gene

This gene was present in the common ancestor of animals.

Orthologs for DHX9 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DHX9 33 34
  • 99.71 (n)
cow
(Bos Taurus)
Mammalia DHX9 33 34
  • 92.13 (n)
dog
(Canis familiaris)
Mammalia DHX9 33 34
  • 91.99 (n)
oppossum
(Monodelphis domestica)
Mammalia DHX9 34
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Dhx9 33 16 34
  • 89.34 (n)
rat
(Rattus norvegicus)
Mammalia Dhx9 33
  • 89.16 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia DHX9 34
  • 88 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia DHX9 34
  • 83 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dhx9 33
  • 74.12 (n)
Str.7575 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.24763 33
zebrafish
(Danio rerio)
Actinopterygii dhx9 33 34
  • 70.28 (n)
Dr.28193 33
fruit fly
(Drosophila melanogaster)
Insecta mle 33 34
  • 54.71 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006599 33
  • 53.36 (n)
worm
(Caenorhabditis elegans)
Secernentea rha-1 33 34
  • 52.53 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 60 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.178 33
Species where no ortholog for DHX9 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DHX9 Gene

ENSEMBL:
Gene Tree for DHX9 (if available)
TreeFam:
Gene Tree for DHX9 (if available)

Paralogs for DHX9 Gene

Paralogs for DHX9 Gene

(2) SIMAP similar genes for DHX9 Gene using alignment to 3 proteins:

Pseudogenes.org Pseudogenes for DHX9 Gene

genes like me logo Genes that share paralogs with DHX9: view

Variants for DHX9 Gene

Sequence variations from dbSNP and Humsavar for DHX9 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000001138 -- 182,865,032(+) CTAAT(A/G)TTTTA intron-variant
rs1000038236 -- 182,852,562(+) TTACT(A/G)CATTT intron-variant
rs1000074146 -- 182,852,246(+) TCCGC(C/T)CCCAC nc-transcript-variant, reference, missense
rs1000118325 -- 182,865,307(+) GTGCA(C/G)AGCAC intron-variant
rs1000160347 -- 182,877,812(+) TAAGT(A/G)GCAAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for DHX9 Gene

Variant ID Type Subtype PubMed ID
esv2537876 CNV insertion 19546169
nsv548358 CNV gain 21841781
nsv998656 CNV gain 25217958

Variation tolerance for DHX9 Gene

Residual Variation Intolerance Score: 1.45% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.96; 19.81% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DHX9 Gene

Human Gene Mutation Database (HGMD)
DHX9
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DHX9

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DHX9 Gene

Disorders for DHX9 Gene

MalaCards: The human disease database

(6) MalaCards diseases for DHX9 Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
pseudopterygium
werner syndrome
  • adult premature ageing syndrome
conjunctival degeneration
endometriosis of uterus
  • endometriosis interna
hypopyon
- elite association - COSMIC cancer census association via MalaCards
Search DHX9 in MalaCards View complete list of genes associated with diseases

Relevant External Links for DHX9

Genetic Association Database (GAD)
DHX9
Human Genome Epidemiology (HuGE) Navigator
DHX9
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DHX9
genes like me logo Genes that share disorders with DHX9: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DHX9 Gene

Publications for DHX9 Gene

  1. Domain structure of human nuclear DNA helicase II (RNA helicase A). (PMID: 9111062) Zhang S … Grosse F (The Journal of biological chemistry 1997) 2 3 4 22 60
  2. Actinomycin D induces histone gamma-H2AX foci and complex formation of gamma-H2AX with Ku70 and nuclear DNA helicase II. (PMID: 15613478) Mischo HE … Zhang S (The Journal of biological chemistry 2005) 3 4 22 60
  3. Arginine methylation of RNA helicase a determines its subcellular localization. (PMID: 15084609) Smith WA … David M (The Journal of biological chemistry 2004) 3 4 22 60
  4. DNA-dependent protein kinase (DNA-PK) phosphorylates nuclear DNA helicase II/RNA helicase A and hnRNP proteins in an RNA-dependent manner. (PMID: 14704337) Zhang S … Grosse F (Nucleic acids research 2004) 3 4 22 60
  5. Antithetic effects of MBD2a on gene regulation. (PMID: 12665568) Fujita H … Nakajima T (Molecular and cellular biology 2003) 3 4 22 60

Products for DHX9 Gene

Sources for DHX9 Gene

Content
Loading form....