Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DHX30 Gene

Aliases for DHX30 Gene

  • DExH-Box Helicase 30 2 3 5
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 30 2 3
  • DEAH-Box Helicase 30 2 3
  • DEAH Box Protein 30 3 4
  • DDX30 3 4
  • DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 3
  • Putative ATP-Dependent RNA Helicase DHX30 3
  • DEAH (Asp-Glu-Ala-His) Box Helicase 30 3
  • Retina Co-Repressor 3
  • EC 3.6.4.13 4
  • KIAA0890 4
  • EC 3.6.1 61
  • RETCOR 3

External Ids for DHX30 Gene

Previous HGNC Symbols for DHX30 Gene

  • DDX30

Previous GeneCards Identifiers for DHX30 Gene

  • GC03P047663
  • GC03P047805
  • GC03P047819
  • GC03P047844

Summaries for DHX30 Gene

Entrez Gene Summary for DHX30 Gene

  • DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The family member encoded by this gene is a mitochondrial nucleoid protein that associates with mitochondrial DNA. It has also been identified as a component of a transcriptional repressor complex that functions in retinal development, and it is required to optimize the function of the zinc-finger antiviral protein. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2013]

GeneCards Summary for DHX30 Gene

DHX30 (DExH-Box Helicase 30) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and chromatin binding. An important paralog of this gene is DHX57.

UniProtKB/Swiss-Prot for DHX30 Gene

  • Plays an important role in the assembly of the mitochondrial large ribosomal subunit (PubMed:25683715). Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA (PubMed:18063578).

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DHX30 Gene

Genomics for DHX30 Gene

Regulatory Elements for DHX30 Gene

Enhancers for DHX30 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03G047778 1.4 Ensembl ENCODE 11.7 -22.1 -22109 5.2 MLX CREB3L1 AGO1 DMAP1 YY1 SLC30A9 ZNF143 SP3 TBX21 MEF2D ZNF589 CCDC12 NME6 BOLA2P2 MRPS18AP1 DHX30 MAP4 SCAP SMARCC1 TMEM89
GH03G047824 1.1 ENCODE 13.1 +22.4 22371 2.3 HDGF HNRNPUL1 ARNT CREB3L1 AGO1 ARID4B SIN3A DMAP1 YY1 CBX5 ZNF589 DHX30 MIR1226 MAP4 CDC25A ENSG00000274420 GC03P047845 PIR41733 GC03P047843 GC03P047842
GH03G047432 1.1 ENCODE 9.7 -368.4 -368372 3.2 HNRNPUL1 HDGF PKNOX1 FOXA2 CREB3L1 MLX ARNT AGO1 ARID4B SIN3A NME6 CCDC12 NBEAL2 SCAP ELP6 PTPN23 CSPG5 BOLA2P2 ZNF589 DHX30
GH03G047961 0.8 ENCODE 10.5 +159.1 159122 0.9 RBBP5 BMI1 ZNF101 ZNF697 ZNF766 GATA3 ELK1 ZNF639 STAT1 RFX1 BOLA2P2 CDC25A RNU7-128P NDUFB1P1 DHX30 ENSG00000260236 VPS26BP1 ENSG00000270285
GH03G047725 0.7 ENCODE 11.3 -77.1 -77144 0.2 SMARCE1 NR2F1 JUN DPF2 FOSL1 ARID1B JUND SMARCA4 IKZF1 NR2C1 DHX30 SMARCC1 ENSG00000235695
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DHX30 on UCSC Golden Path with GeneCards custom track

Promoters for DHX30 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000152040 191 1801 HDGF PKNOX1 FOXA2 CREB3L1 AGO1 ARID4B SIN3A DMAP1 ZNF207 ZNF143

Genomic Location for DHX30 Gene

Chromosome:
3
Start:
47,802,909 bp from pter
End:
47,850,196 bp from pter
Size:
47,288 bases
Orientation:
Plus strand

Genomic View for DHX30 Gene

Genes around DHX30 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DHX30 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DHX30 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DHX30 Gene

Proteins for DHX30 Gene

  • Protein details for DHX30 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q7L2E3-DHX30_HUMAN
    Recommended name:
    Putative ATP-dependent RNA helicase DHX30
    Protein Accession:
    Q7L2E3
    Secondary Accessions:
    • A8K5F1
    • O94965
    • Q7Z753
    • Q96CH4
    • Q9NUQ0

    Protein attributes for DHX30 Gene

    Size:
    1194 amino acids
    Molecular mass:
    133938 Da
    Quaternary structure:
    • Identified in a complex with TFAM and SSBP1. Interacts with AGO1 and AGO2. Interacts (via N-terminus) with ZC3HAV1 (via N-terminal domain) in an RNA-independent manner (By similarity). Found in a complex with GRSF1, DDX28, FASTKD2 and FASTKD5 (PubMed:25683715).
    SequenceCaution:
    • Sequence=BAA74913.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAA92071.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for DHX30 Gene

    Alternative splice isoforms for DHX30 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DHX30 Gene

Selected DME Specific Peptides for DHX30 Gene

Q7L2E3:
  • EGRGARCNV
  • KVPGFMYPVKE
  • EHGQLLALLAELLRGPCGSFD
  • IKAVDEAVILLQEIGVLDQRE
  • HKEERYDLKTKVSCLETVWVS
  • ISTDPRLAKAIVLA
  • LRLVLMSATGDN
  • RRALGRMVERSLRSELAALP
  • QRRGRAGR
  • QAKIHMPEKTAVEFLSKA
  • VFVRDSSQVHPLAVLL
  • VLATNIAET
  • RCLHPLLV
  • VDEVHER
  • YSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNS
  • GILLRKLQ
  • LTRDPFS
  • KKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYR
  • KLKSLGLVD
  • FLVGKPS
  • NPSLEGVSHV
  • AETSITI
  • GDTGCGK
  • SRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKP
  • SRDLLKEFPQPKNLLNSVIGRALGISHA
  • KKKVTLHIKWPK
  • PEILRTPLE
  • SRWLTYFMAVKSNG
  • TVGTKTK
  • EAENKAAALAC
  • WQEAPQLPVDPHRDTIL
  • LPVHSNIPMMDQ
  • FLSMTQQDSH
  • TNIAETS
  • TQPRRISA
  • WPCPMTF
  • AIRALTQFPLPKNLLA
  • GEPGGILCFLPGWQEIKGVQQRL
  • VIQIATSSST
  • LLHKSTINREA

Post-translational modifications for DHX30 Gene

Domains & Families for DHX30 Gene

Gene Families for DHX30 Gene

Suggested Antigen Peptide Sequences for DHX30 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q7L2E3

UniProtKB/Swiss-Prot:

DHX30_HUMAN :
  • Belongs to the DEAD box helicase family. DEAH subfamily.
Family:
  • Belongs to the DEAD box helicase family. DEAH subfamily.
genes like me logo Genes that share domains with DHX30: view

Function for DHX30 Gene

Molecular function for DHX30 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
Plays an important role in the assembly of the mitochondrial large ribosomal subunit (PubMed:25683715). Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA (PubMed:18063578).

Enzyme Numbers (IUBMB) for DHX30 Gene

Gene Ontology (GO) - Molecular Function for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003682 chromatin binding IDA 18063578
GO:0003723 RNA binding IEA,IDA 22658674
GO:0003725 double-stranded RNA binding IDA 21266579
GO:0004004 ATP-dependent RNA helicase activity IBA --
genes like me logo Genes that share ontologies with DHX30: view
genes like me logo Genes that share phenotypes with DHX30: view

Animal Models for DHX30 Gene

MGI Knock Outs for DHX30:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DHX30 Gene

Localization for DHX30 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DHX30 Gene

Isoform 2: Cytoplasm.
Isoform 1: Cytoplasm.
Mitochondrion. Cytoplasm. Mitochondrion matrix, mitochondrion nucleoid. Note=Localizes to mitochondrial RNA granules found in close proximity to the mitochondrial nucleoids. {ECO:0000269 PubMed:25683715}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DHX30 gene
Compartment Confidence
mitochondrion 5
cytosol 5
nucleus 3

Gene Ontology (GO) - Cellular Components for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IDA --
GO:0005829 cytosol IDA --
GO:0035770 ribonucleoprotein granule IDA 25683715
GO:0042645 mitochondrial nucleoid IDA,IEA 18063578
genes like me logo Genes that share ontologies with DHX30: view

Pathways & Interactions for DHX30 Gene

SuperPathways for DHX30 Gene

No Data Available

Gene Ontology (GO) - Biological Process for DHX30 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006396 RNA processing IBA --
GO:0042254 ribosome biogenesis IEA --
GO:1902775 mitochondrial large ribosomal subunit assembly IMP 25683715
genes like me logo Genes that share ontologies with DHX30: view

No data available for Pathways by source and SIGNOR curated interactions for DHX30 Gene

Drugs & Compounds for DHX30 Gene

(3) Drugs for DHX30 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for DHX30 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with DHX30: view

Transcripts for DHX30 Gene

Unigene Clusters for DHX30 Gene

DEAH (Asp-Glu-Ala-His) box polypeptide 30:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for DHX30 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10 ^ 11a · 11b · 11c ^ 12a · 12b ^ 13 ^ 14a · 14b · 14c · 14d ^
SP1: - - - - -
SP2: - - - - - -
SP3: - - - - -
SP4: - - - -
SP5: - - - - -
SP6:
SP7: - - - -
SP8: - - - - -
SP9:
SP10:
SP11:
SP12:

ExUns: 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b ^ 22 ^ 23 ^ 24 ^ 25 ^ 26
SP1:
SP2:
SP3: - - - - - - - - - - - -
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for DHX30 Gene

GeneLoc Exon Structure for
DHX30
ECgene alternative splicing isoforms for
DHX30

Expression for DHX30 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DHX30 Gene

Protein differential expression in normal tissues from HIPED for DHX30 Gene

This gene is overexpressed in Bone marrow stromal cell (33.0) and Peripheral blood mononuclear cells (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DHX30 Gene



Protein tissue co-expression partners for DHX30 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DHX30 Gene:

DHX30

SOURCE GeneReport for Unigene cluster for DHX30 Gene:

Hs.517948

Evidence on tissue expression from TISSUES for DHX30 Gene

  • Nervous system(4.8)
  • Liver(4.3)
  • Skin(3.6)
  • Eye(3)
  • Lung(2.2)
genes like me logo Genes that share expression patterns with DHX30: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for DHX30 Gene

Orthologs for DHX30 Gene

This gene was present in the common ancestor of chordates.

Orthologs for DHX30 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DHX30 34 35
  • 98.99 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 97 (a)
OneToMany
-- 35
  • 83 (a)
OneToMany
dog
(Canis familiaris)
Mammalia DHX30 34 35
  • 91.74 (n)
cow
(Bos Taurus)
Mammalia DHX30 34 35
  • 91.22 (n)
rat
(Rattus norvegicus)
Mammalia Dhx30 34
  • 90.23 (n)
oppossum
(Monodelphis domestica)
Mammalia DHX30 35
  • 90 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Dhx30 34 16 35
  • 89.15 (n)
chicken
(Gallus gallus)
Aves DHX30 34 35
  • 75.21 (n)
lizard
(Anolis carolinensis)
Reptilia DHX30 35
  • 76 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dhx30 34
  • 67.42 (n)
Str.344 34
zebrafish
(Danio rerio)
Actinopterygii dhx30 34
  • 58.56 (n)
DHX30 35
  • 48 (a)
OneToOne
Species where no ortholog for DHX30 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for DHX30 Gene

ENSEMBL:
Gene Tree for DHX30 (if available)
TreeFam:
Gene Tree for DHX30 (if available)

Paralogs for DHX30 Gene

Paralogs for DHX30 Gene

(2) SIMAP similar genes for DHX30 Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with DHX30: view

Variants for DHX30 Gene

Sequence variations from dbSNP and Humsavar for DHX30 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
rs1057519436 Pathogenic 47,846,550(+) TCGCC(A/G)CATCT reference, missense
rs753242774 Pathogenic 47,848,237(+) GGGGC(A/C/T)GGGCG upstream-variant-2KB, reference, synonymous-codon
rs1000011158 -- 47,836,554(+) TGCTC(-/TG)TTGCC intron-variant
rs1000047365 -- 47,801,001(+) TCAAC(A/C)CTTTC upstream-variant-2KB
rs1000061658 -- 47,816,390(+) GTCTT(G/T)TTCTG intron-variant, nc-transcript-variant

Structural Variations from Database of Genomic Variants (DGV) for DHX30 Gene

Variant ID Type Subtype PubMed ID
esv3561844 CNV deletion 23714750
nsv1006560 CNV gain 25217958
nsv10270 CNV gain 18304495
nsv1136722 CNV deletion 24896259
nsv231 CNV insertion 15895083
nsv3808 CNV insertion 18451855
nsv472381 CNV novel sequence insertion 20440878
nsv473806 CNV novel sequence insertion 20440878
nsv508916 CNV insertion 20534489
nsv834679 CNV loss 17160897

Variation tolerance for DHX30 Gene

Residual Variation Intolerance Score: 1.75% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.94; 19.40% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DHX30 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
DHX30

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DHX30 Gene

Disorders for DHX30 Gene

Relevant External Links for DHX30

Genetic Association Database (GAD)
DHX30
Human Genome Epidemiology (HuGE) Navigator
DHX30
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DHX30

No disorders were found for DHX30 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for DHX30 Gene

Publications for DHX30 Gene

  1. Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10048485) Nagase T. … Ohara O. (DNA Res. 1998) 2 3 4 64
  2. Mitochondrial RNA granules are centers for posttranscriptional RNA processing and ribosome biogenesis. (PMID: 25683715) Antonicka H. … Shoubridge E.A. (Cell Rep. 2015) 3 4 64
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  4. The layered structure of human mitochondrial DNA nucleoids. (PMID: 18063578) Bogenhagen D.F. … Burke S. (J. Biol. Chem. 2008) 3 4 64
  5. The packaging of human immunodeficiency virus type 1 RNA is restricted by overexpression of an RNA helicase DHX30. (PMID: 18022663) Zhou Y. … Liang C. (Virology 2008) 2 3 64

Products for DHX30 Gene

Sources for DHX30 Gene

Content
Loading form....