Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DDX5 Gene

Aliases for DDX5 Gene

  • DEAD-Box Helicase 5 2 3 5
  • DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 5 (RNA Helicase, 68kD) 2 3
  • DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 2 3
  • DEAD (Asp-Glu-Ala-Asp) Box Helicase 5 2 3
  • DEAD Box Protein 5 3 4
  • RNA Helicase P68 3 4
  • G17P1 3 4
  • HLR1 3 4
  • Probable ATP-Dependent RNA Helicase DDX5 3
  • ATP-Dependent RNA Helicase DDX5 3
  • EC 3.6.4.13 4
  • DEAD Box-5 3
  • EC 3.6.1 61
  • HUMP68 3
  • HELR 4
  • P68 3

External Ids for DDX5 Gene

Previous HGNC Symbols for DDX5 Gene

  • HLR1
  • G17P1

Previous GeneCards Identifiers for DDX5 Gene

  • GC17M065876
  • GC17P068976
  • GC17M062913
  • GC17M063045
  • GC17M059926
  • GC17M062494
  • GC17M057943

Summaries for DDX5 Gene

Entrez Gene Summary for DDX5 Gene

  • DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

GeneCards Summary for DDX5 Gene

DDX5 (DEAD-Box Helicase 5) is a Protein Coding gene. Among its related pathways are Transcriptional misregulation in cancer and mRNA Splicing - Major Pathway. GO annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is DDX17.

UniProtKB/Swiss-Prot for DDX5 Gene

  • Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.

Gene Wiki entry for DDX5 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DDX5 Gene

Genomics for DDX5 Gene

Regulatory Elements for DDX5 Gene

Enhancers for DDX5 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17F064983 1.7 FANTOM5 Ensembl ENCODE 16.4 -477.2 -477173 4.5 HDGF PKNOX1 ATF1 SIN3A YBX1 ZNF143 ZNF207 FOS ZHX2 TBX21 AMZ2P1 GNA13 DDX5 CEP95 RGS9 LRRC37A3 GC17P064985
GH17F064073 1.7 FANTOM5 Ensembl ENCODE 13.9 +432.3 432304 4.8 PKNOX1 MLX ARID4B SIN3A DMAP1 YY1 GATA2 ZNF207 FOS ZHX2 ERN1 DDX5 GH1 CSHL1 MAP3K3 LIMD2 ICAM2 PECAM1 MILR1 GC17M064041
GH17F064059 1.7 FANTOM5 Ensembl ENCODE 11.8 +443.9 443939 9.5 HDGF PKNOX1 ARNT CREB3L1 WRNIP1 ARID4B ZNF766 CBX5 KLF13 MCM3 ERN1 ENSG00000265982 CSHL1 GH1 DDX5 SCN4A PLEKHM1P1 SNORD104 CD79B ENSG00000265218
GH17F064501 1.2 ENCODE 13.8 +3.4 3427 7.7 CREB3L1 YBX1 FEZF1 DMAP1 YY1 ZNF143 ZNF263 SP3 NFYC TBX21 POLG2 SLC16A6P1 CEP95 DDX42 ENSG00000265982 PLEKHM1P1 MIR3064 ENSG00000265218 RN7SL404P CSH2
GH17F064090 1.6 FANTOM5 Ensembl ENCODE 8.8 +416.0 416020 2.4 HDGF ATF1 PKNOX1 ARNT CREB3L1 YY1 ZNF766 GATA2 FOS JUNB ERN1 PECAM1 MAP3K3 CSHL1 GH1 SNORD104 DDX5 LIMD2 ICAM2 GC17M064041
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DDX5 on UCSC Golden Path with GeneCards custom track

Promoters for DDX5 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001268924 1699 4600 CREB3L1 YBX1 FEZF1 DMAP1 YY1 ZNF143 ZNF263 SP3 NFYC TBX21

Genomic Location for DDX5 Gene

Chromosome:
17
Start:
64,498,256 bp from pter
End:
64,508,199 bp from pter
Size:
9,944 bases
Orientation:
Minus strand

Genomic View for DDX5 Gene

Genes around DDX5 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DDX5 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DDX5 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DDX5 Gene

Proteins for DDX5 Gene

  • Protein details for DDX5 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P17844-DDX5_HUMAN
    Recommended name:
    Probable ATP-dependent RNA helicase DDX5
    Protein Accession:
    P17844
    Secondary Accessions:
    • B4DLW8
    • B5BU21
    • D3DU32
    • E7ETL9
    • O75681
    • Q53Y61

    Protein attributes for DDX5 Gene

    Size:
    614 amino acids
    Molecular mass:
    69148 Da
    Quaternary structure:
    • Identified in the spliceosome C complex. Interacts with RBM4; the interaction occurs in an RNA-independent manner. Interacts with AGO1 and AGO2. Interacts with ESR1; the interaction is enhanced by phosphorylation of ESR1 AF-1 domain. Interacts with AR, NCOA1, NCOA2, NCOA3, EP300, CREBBP, POLR2A, TP53, RUNX2 and HDAC1. Self-associates. Interacts with DDX17. Interacts with BRDT. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active).
    • Identified in the spliceosome C complex. Interacts with RBM4; the interaction occurs in an RNA-independent manner. Interacts with AGO1 and AGO2. Interacts with ESR1; the interaction is enhanced by phosphorylation of ESR1 AF-1 domain. Interacts with AR, NCOA1, NCOA2, NCOA3, EP300, CREBBP, POLR2A, TP53, RUNX2 and HDAC1. Self-associates. Interacts with DDX17. Interacts with BRDT. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active).
    • Identified in the spliceosome C complex. Interacts with RBM4; the interaction occurs in an RNA-independent manner. Interacts with AGO1 and AGO2. Interacts with ESR1; the interaction is enhanced by phosphorylation of ESR1 AF-1 domain. Interacts with AR, NCOA1, NCOA2, NCOA3, EP300, CREBBP, POLR2A, TP53, RUNX2 and HDAC1. Self-associates. Interacts with DDX17. Interacts with BRDT. The large PER complex involved in the repression of transcriptional termination is composed of at least PER2, CDK9, DDX5, DHX9, NCBP1 and POLR2A (active).

    Three dimensional structures from OCA and Proteopedia for DDX5 Gene

    Alternative splice isoforms for DDX5 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DDX5 Gene

Selected DME Specific Peptides for DDX5 Gene

P17844:
  • MRRDGWPAM
  • DMGFEPQ
  • YGGAPKG
  • DEADRML
  • VASRGLD
  • PTRELAQQ
  • VLDEADRM
  • VFVETKR
  • TDVASRG
  • NMHNGMNQQAYAYP
  • QLAEDFL
  • KKFGNPGE
  • LPAIVHIN
  • AQTGSGKT
  • FVETKRRCD
  • LAPTREL
  • HRIGRTAR
  • LELSANHNILQIVDVC
  • TGSGKTLS
  • TPGRLID
  • ILIATDVA
  • LVLDEADR
  • TYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIAR
  • MWSATWPK
  • FEKNFYQEHPD
  • QIRPDRQT
  • IHGDKSQ
  • SATWPKEV
  • VLREANQ
  • APTRELA
  • YSSDRDRGRDRGFGAPRFGGSR
  • GPQIRDL
  • GKTNLRR
  • IATPGRL
  • PKFEKNFY
  • EANQAINPKL
  • YIHRIGR

Post-translational modifications for DDX5 Gene

  • Arg-502 is dimethylated, probably to asymmetric dimethylarginine.
  • Polyubiquitinated, leading to proteasomal degradation.
  • Sumoylated; sumoylation, promoted by PIAS1, promotes interaction with HDAC1 and transcriptional repression activity. Sumoylation also significantly increases stability, and reduces polyubiquitination.
  • Ubiquitination at Lys 56, Lys 91, Lys 236, Lys 340, Lys 351, Lys 375, Lys 388, Lys 411, Lys 437, Lys 451, and Lys 529
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for DDX5 (DDX5)
  • Abcam antibodies for DDX5

Domains & Families for DDX5 Gene

Gene Families for DDX5 Gene

Suggested Antigen Peptide Sequences for DDX5 Gene

Graphical View of Domain Structure for InterPro Entry

P17844

UniProtKB/Swiss-Prot:

DDX5_HUMAN :
  • Contains 1 helicase ATP-binding domain.
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
Domain:
  • Contains 1 helicase ATP-binding domain.
  • Contains 1 helicase C-terminal domain.
Family:
  • Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
genes like me logo Genes that share domains with DDX5: view

Function for DDX5 Gene

Molecular function for DDX5 Gene

GENATLAS Biochemistry:
DEAD/H box protein 5,putative RNA helicase
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + H(2)O = ADP + phosphate.
UniProtKB/Swiss-Prot Function:
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specific manner; the function probably involves association with histone deacetylases, such as HDAC1. As component of a large PER complex is involved in the inhibition of 3 transcriptional termination of circadian target genes such as PER1 and NR1D1 and the control of the circadian rhythms.

Enzyme Numbers (IUBMB) for DDX5 Gene

Gene Ontology (GO) - Molecular Function for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003676 nucleic acid binding IEA --
GO:0003712 transcription cofactor activity IEA --
GO:0003713 transcription coactivator activity IDA --
GO:0003723 RNA binding IEA --
genes like me logo Genes that share ontologies with DDX5: view
genes like me logo Genes that share phenotypes with DDX5: view

Animal Models for DDX5 Gene

MGI Knock Outs for DDX5:

Animal Model Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DDX5

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DDX5 Gene

Localization for DDX5 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DDX5 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DDX5 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 1

Gene Ontology (GO) - Cellular Components for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus NAS 2451786
GO:0005654 nucleoplasm IDA,TAS --
GO:0005681 spliceosomal complex IEA --
GO:0005730 nucleolus IEA,IDA 10837141
GO:0016020 membrane IDA 19946888
genes like me logo Genes that share ontologies with DDX5: view

Pathways & Interactions for DDX5 Gene

genes like me logo Genes that share pathways with DDX5: view

Pathways by source for DDX5 Gene

2 Cell Signaling Technology pathways for DDX5 Gene
1 BioSystems pathway for DDX5 Gene

SIGNOR curated interactions for DDX5 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for DDX5 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter IDA 15298701
GO:0000381 regulation of alternative mRNA splicing, via spliceosome IEA,IDA 21343338
GO:0000398 mRNA splicing, via spliceosome IC,TAS --
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
genes like me logo Genes that share ontologies with DDX5: view

Drugs & Compounds for DDX5 Gene

(6) Drugs for DDX5 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
Adenosine triphosphate Approved Nutra 0

(2) Additional Compounds for DDX5 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with DDX5: view

Transcripts for DDX5 Gene

Unigene Clusters for DDX5 Gene

DEAD (Asp-Glu-Ala-Asp) box helicase 5:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DDX5

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for DDX5 Gene

ExUns: 1 ^ 2a · 2b ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b · 5c ^ 6a · 6b · 6c ^ 7a · 7b · 7c ^ 8a · 8b ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b · 12c ·
SP1: - - - -
SP2:
SP3: - - -
SP4: - - -
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - - - - - - - - - - - - -
SP13: - - - -
SP14: -
SP15: -
SP16:
SP17:
SP18:
SP19:

ExUns: 12d · 12e · 12f ^ 13 ^ 14a · 14b · 14c · 14d · 14e ^ 15a · 15b ^ 16 ^ 17a · 17b · 17c · 17d ^ 18a · 18b · 18c · 18d
SP1: - - - - - - - - - -
SP2: - - - - - - - - -
SP3:
SP4:
SP5:
SP6:
SP7: - - -
SP8: - - - -
SP9: - - - - - - - -
SP10: - - - - - - -
SP11: - -
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18: - -
SP19:

Relevant External Links for DDX5 Gene

GeneLoc Exon Structure for
DDX5
ECgene alternative splicing isoforms for
DDX5

Expression for DDX5 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for DDX5 Gene

Protein differential expression in normal tissues from HIPED for DDX5 Gene

This gene is overexpressed in Lymph node (13.1) and Peripheral blood mononuclear cells (7.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DDX5 Gene



Protein tissue co-expression partners for DDX5 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of DDX5 Gene:

DDX5

SOURCE GeneReport for Unigene cluster for DDX5 Gene:

Hs.279806
genes like me logo Genes that share expression patterns with DDX5: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for DDX5 Gene

Orthologs for DDX5 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for DDX5 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DDX5 34 35
  • 99.57 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 98 (a)
OneToMany
-- 35
  • 94 (a)
OneToMany
dog
(Canis familiaris)
Mammalia DDX5 34 35
  • 96.63 (n)
cow
(Bos Taurus)
Mammalia DDX5 34 35
  • 95.49 (n)
mouse
(Mus musculus)
Mammalia Ddx5 34 16 35
  • 94.08 (n)
rat
(Rattus norvegicus)
Mammalia Ddx5 34
  • 94.08 (n)
oppossum
(Monodelphis domestica)
Mammalia DDX5 35
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves DDX5 34 35
  • 83.11 (n)
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 89 (a)
OneToMany
-- 35
  • 82 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia ddx5 34
  • 74.51 (n)
MGC76265 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.648 34
zebrafish
(Danio rerio)
Actinopterygii ddx5 34 35
  • 73.59 (n)
Dr.28420 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.10528 34
fruit fly
(Drosophila melanogaster)
Insecta Rm62 36 35
  • 65 (a)
CG10077 36 34 35
  • 59.93 (n)
CG10777 36 35
  • 58 (a)
CG14443 36
  • 32 (a)
worm
(Caenorhabditis elegans)
Secernentea F58E10.3 36
  • 59 (a)
ddx-17 35
  • 50 (a)
OneToMany
F58G11.2 36
  • 30 (a)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F23716g 34
  • 61.02 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AFL221C 34
  • 58.42 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes DBP2 34 35 37
  • 57.99 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G55150 34
  • 60.09 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.9145 34
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes dbp2 34
  • 58.94 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU07839 34
  • 57.72 (n)
Species where no ortholog for DDX5 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DDX5 Gene

ENSEMBL:
Gene Tree for DDX5 (if available)
TreeFam:
Gene Tree for DDX5 (if available)

Paralogs for DDX5 Gene

Variants for DDX5 Gene

Sequence variations from dbSNP and Humsavar for DDX5 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs10186 -- 64,499,848(-) TAGTT(A/G)TTTAA utr-variant-3-prime
rs1050485 -- 64,499,815(-) GACTG(C/T)AGTGC utr-variant-3-prime
rs10512502 -- 64,498,891(+) GTTGC(C/T)TCCTG upstream-variant-2KB, utr-variant-3-prime
rs10682250 -- 64,504,992(+) AAATC(-/TCTCCT)TCTCT intron-variant, upstream-variant-2KB
rs10700816 -- 64,504,996(+) CTCTC(-/CTTCTC)AACAG intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for DDX5 Gene

Variant ID Type Subtype PubMed ID
nsv475380 CNV novel sequence insertion 20440878

Variation tolerance for DDX5 Gene

Residual Variation Intolerance Score: 9.84% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.19; 51.99% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DDX5 Gene

Human Gene Mutation Database (HGMD)
DDX5
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DDX5

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DDX5 Gene

Disorders for DDX5 Gene

Relevant External Links for DDX5

Genetic Association Database (GAD)
DDX5
Human Genome Epidemiology (HuGE) Navigator
DDX5
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DDX5

No disorders were found for DDX5 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for DDX5 Gene

Publications for DDX5 Gene

  1. Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential. (PMID: 19995069) Mooney S.M. … Janknecht R. (Biochemistry 2010) 3 4 22 64
  2. The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer. (PMID: 19718048) Wortham N.C. … Fuller-Pace F.V. (Oncogene 2009) 3 4 22 64
  3. P68 RNA helicase (DDX5) alters activity of cis- and trans-acting factors of the alternative splicing of H-Ras. (PMID: 18698352) Camats M. … Bach-Elias M. (PLoS ONE 2008) 2 3 22 64
  4. p68 (Ddx5) interacts with Runx2 and regulates osteoblast differentiation. (PMID: 17960593) Jensen E.D. … Westendorf J.J. (J. Cell. Biochem. 2008) 3 4 22 64
  5. SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1. (PMID: 17369852) Jacobs A.M. … Fuller-Pace F.V. (Oncogene 2007) 3 4 22 64

Products for DDX5 Gene

Sources for DDX5 Gene

Content
Loading form....