Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DAPK3 Gene

Aliases for DAPK3 Gene

  • Death Associated Protein Kinase 3 2 3 5
  • Zipper-Interacting Protein Kinase 3 4
  • DAP-Like Kinase 3 4
  • DAP Kinase 3 3 4
  • MYPT1 Kinase 3 4
  • EC 2.7.11.1 4 56
  • ZIP-Kinase 3 4
  • ZIPK 3 4
  • DLK 3 4
  • Death-Associated Protein Kinase 3 3
  • EC 2.7.11 56
  • ZIP 3

External Ids for DAPK3 Gene

Previous GeneCards Identifiers for DAPK3 Gene

  • GC19M004050
  • GC19M003898
  • GC19M003909
  • GC19M003721

Summaries for DAPK3 Gene

Entrez Gene Summary for DAPK3 Gene

  • Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008]

GeneCards Summary for DAPK3 Gene

DAPK3 (Death Associated Protein Kinase 3) is a Protein Coding gene. Diseases associated with DAPK3 include Recessive Dystrophic Epidermolysis Bullosa. Among its related pathways are Regulation by c-FLIP and CDK-mediated phosphorylation and removal of Cdc6. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is DAPK1.

UniProtKB/Swiss-Prot for DAPK3 Gene

  • Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-dependent) apoptotic and type II (caspase-independent) autophagic cell deaths signal, depending on the cellular setting. Involved in regulation of starvation-induced autophagy. Regulates myosin phosphorylation in both smooth muscle and non-muscle cells. In smooth muscle, regulates myosin either directly by phosphorylating MYL12B and MYL9 or through inhibition of smooth muscle myosin phosphatase (SMPP1M) via phosphorylation of PPP1R12A; the inhibition of SMPP1M functions to enhance muscle responsiveness to Ca(2+) and promote a contractile state. Phosphorylates MYL12B in non-muscle cells leading to reorganization of actin cytoskeleton. Isoform 2 can phosphorylate myosin, PPP1R12A and MYL12B. Overexpression leads to condensation of actin stress fibers into thick bundles. Involved in actin filament focal adhesion dynamics. The function in both reorganization of actin cytoskeleton and focal adhesion dissolution is modulated by RhoD. Positively regulates canonical Wnt/beta-catenin signaling through interaction with NLK and TCF7L2. Phosphorylates RPL13A on Ser-77 upon interferon-gamma activation which is causing RPL13A release from the ribosome, RPL13A association with the GAIT complex and its subsequent involvement in transcript-selective translation inhibition. Enhances transcription from AR-responsive promoters in a hormone- and kinase-dependent manner. Involved in regulation of cell cycle progression and cell proliferation. May be a tumor suppressor.

Gene Wiki entry for DAPK3 Gene

Additional gene information for DAPK3 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DAPK3 Gene

Genomics for DAPK3 Gene

GeneHancer (GH) Regulatory Elements for DAPK3 Gene

Promoters and enhancers for DAPK3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH19I003965 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 556.1 +2.3 2291 5.9 HDGF PKNOX1 FOXA2 MLX ARID4B NEUROD1 SIN3A FEZF1 DMAP1 ZBTB7B DAPK3 CACTIN-AS1 PIAS4 PLIN5 GC19M003970 MIR637
GH19I003849 Enhancer 0.7 ENCODE 11.9 +121.8 121765 0.2 MEIS2 CTCF RB1 RAD21 CC2D1A SCRT2 ZNF143 SMC3 CREM DEK ATCAY MIR637 DAPK3 EEF2 PIR53050 GC19P003837 ZFR2
GH19I003961 Enhancer 0.2 dbSUPER 0.4 +9.7 9672 0.8 GC19M003962 MIR637 GC19P003961 DAPK3
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around DAPK3 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the DAPK3 gene promoter:

Genomic Locations for DAPK3 Gene

Genomic Locations for DAPK3 Gene
chr19:3,958,453-3,971,123
(GRCh38/hg38)
Size:
12,671 bases
Orientation:
Minus strand
chr19:3,958,451-3,971,121
(GRCh37/hg19)

Genomic View for DAPK3 Gene

Genes around DAPK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DAPK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DAPK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DAPK3 Gene

Proteins for DAPK3 Gene

  • Protein details for DAPK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43293-DAPK3_HUMAN
    Recommended name:
    Death-associated protein kinase 3
    Protein Accession:
    O43293
    Secondary Accessions:
    • A0AVN4
    • B3KQE2
    • Q05JY4

    Protein attributes for DAPK3 Gene

    Size:
    454 amino acids
    Molecular mass:
    52536 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homooligomer in its kinase-active form (homotrimers and homodimers are reported); monomeric in its kinase-inactive form. Homodimerization is required for activation segment autophosphorylation (Probable). Isoform 1 and isoform 2 interact with myosin and PPP1R12A; interaction of isoform 1 with PPP1R12A is inhibited by RhoA dominant negative form. Interacts with NLK, DAXX, STAT3, RHOD (GTP-bound form) and TCP10L. Interacts with PAWR; the interaction is reported conflictingly: according to PubMed:17953487 does not interact with PAWR. Interacts with ULK1; may be a substrate of ULK1.

    Three dimensional structures from OCA and Proteopedia for DAPK3 Gene

    Alternative splice isoforms for DAPK3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DAPK3 Gene

Selected DME Specific Peptides for DAPK3 Gene

O43293:
  • TSELAKDFIR
  • IRRLLVKD
  • GGELFDFLAEKESLTE
  • GVITYILL
  • GEELGSGQFA
  • GTPEFVAPE
  • IAHFDLKPENIMLLD
  • EFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILL
  • TDVVLILELVSGGELFDFLA

Post-translational modifications for DAPK3 Gene

  • The phosphorylation status is critical for kinase activity, oligomerization and intracellular localization. Phosphorylation at Thr-180, Thr-225 and Thr-265 is essential for activity. The phosphorylated form is localized in the cytoplasm promoted by phosphorylation at Thr-299; nuclear translocation or retention is maximal when it is not phosphorylated. Phosphorylation increases the trimeric form, and its dephosphorylation favors a kinase-inactive monomeric form. Both isoform 1 and isoform 2 can undergo autophosphorylation.

Other Protein References for DAPK3 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for DAPK3 (DAPK3)

Domains & Families for DAPK3 Gene

Gene Families for DAPK3 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for DAPK3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O43293

UniProtKB/Swiss-Prot:

DAPK3_HUMAN :
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
genes like me logo Genes that share domains with DAPK3: view

Function for DAPK3 Gene

Molecular function for DAPK3 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=12 uM for myosin (isoform 2) {ECO:0000269 PubMed:17126281}; KM=6.2 uM for myosin (isoform 1) {ECO:0000269 PubMed:17126281}; KM=73 uM for MYL12B (isoform 2) {ECO:0000269 PubMed:17126281}; KM=10.4 uM for MYL12B (isoform 1) {ECO:0000269 PubMed:17126281}; Vmax=248 nmol/min/mg enzyme toward myosin (isoform 2) {ECO:0000269 PubMed:17126281}; Vmax=120 nmol/min/mg enzyme toward myosin (isoform 1) {ECO:0000269 PubMed:17126281}; Vmax=1.3 umol/min/mg enzyme toward MYL12B (isoform 2) {ECO:0000269 PubMed:17126281}; Vmax=271 nmol/min/mg enzyme toward MYL12B (isoform 1) {ECO:0000269 PubMed:17126281};
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
A sequential activation is proposed: autophosphorylation at consensus sites is leading to dimerization of the catalytic domain stabilized by phosphorylation at Ser-50 and activation segment exchange (producing an active confirmation of both kinase modules in trans) followed by phosphorylation at Thr-180 in the activation segment and at other regulatory sites (Probable). Phosphorylation at Thr-180, Thr-225 and Thr-265 is essential for activity. Oligomerization is required for full enzymatic activity. Inhibited by pyridone 6 (K00225), a potent, ATP-competitive inhibitor.
UniProtKB/Swiss-Prot Function:
Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-dependent) apoptotic and type II (caspase-independent) autophagic cell deaths signal, depending on the cellular setting. Involved in regulation of starvation-induced autophagy. Regulates myosin phosphorylation in both smooth muscle and non-muscle cells. In smooth muscle, regulates myosin either directly by phosphorylating MYL12B and MYL9 or through inhibition of smooth muscle myosin phosphatase (SMPP1M) via phosphorylation of PPP1R12A; the inhibition of SMPP1M functions to enhance muscle responsiveness to Ca(2+) and promote a contractile state. Phosphorylates MYL12B in non-muscle cells leading to reorganization of actin cytoskeleton. Isoform 2 can phosphorylate myosin, PPP1R12A and MYL12B. Overexpression leads to condensation of actin stress fibers into thick bundles. Involved in actin filament focal adhesion dynamics. The function in both reorganization of actin cytoskeleton and focal adhesion dissolution is modulated by RhoD. Positively regulates canonical Wnt/beta-catenin signaling through interaction with NLK and TCF7L2. Phosphorylates RPL13A on Ser-77 upon interferon-gamma activation which is causing RPL13A release from the ribosome, RPL13A association with the GAIT complex and its subsequent involvement in transcript-selective translation inhibition. Enhances transcription from AR-responsive promoters in a hormone- and kinase-dependent manner. Involved in regulation of cell cycle progression and cell proliferation. May be a tumor suppressor.

Enzyme Numbers (IUBMB) for DAPK3 Gene

Phenotypes From GWAS Catalog for DAPK3 Gene

Gene Ontology (GO) - Molecular Function for DAPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS 16756490
GO:0005515 protein binding IPI 15292222
GO:0005524 ATP binding IDA 10356987
GO:0008022 protein C-terminus binding IEA --
genes like me logo Genes that share ontologies with DAPK3: view
genes like me logo Genes that share phenotypes with DAPK3: view

Animal Model Products

miRNA for DAPK3 Gene

miRTarBase miRNAs that target DAPK3

Clone Products

  • Addgene plasmids for DAPK3

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for DAPK3 Gene

Localization for DAPK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DAPK3 Gene

Nucleus. Cytoplasm. Note=Predominantly localizes to the cytoplasm but can shuttle between the nucleus and cytoplasm; cytoplasmic localization is promoted by phosphorylation at Thr-299 and involves Rho/Rock signaling. {ECO:0000269 PubMed:17953487, ECO:0000269 PubMed:20854903}.
Isoform 1: Nucleus. Cytoplasm.
Isoform 2: Nucleus. Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DAPK3 gene
Compartment Confidence
nucleus 5
cytoskeleton 3
cytosol 3

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for DAPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus ISS,TAS --
GO:0005737 cytoplasm IBA --
GO:0005884 actin filament IEA --
GO:0016605 PML body IEA --
GO:0045121 membrane raft IEA --
genes like me logo Genes that share ontologies with DAPK3: view

Pathways & Interactions for DAPK3 Gene

genes like me logo Genes that share pathways with DAPK3: view

Pathways by source for DAPK3 Gene

2 Sino Biological pathways for DAPK3 Gene
1 Cell Signaling Technology pathway for DAPK3 Gene
1 BioSystems pathway for DAPK3 Gene

SIGNOR curated interactions for DAPK3 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for DAPK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated TAS --
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation IDA 10356987
GO:0006915 apoptotic process IMP 12917339
genes like me logo Genes that share ontologies with DAPK3: view

Drugs & Compounds for DAPK3 Gene

(9) Drugs for DAPK3 Gene - From: DrugBank, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved Nutra 0
(4R)-7,8-dichloro-1',9-dimethyl-1-oxo-1,2,4,9-tetrahydrospiro[beta-carboline-3,4'-piperidine]-4-carbonitrile Experimental Pharma Target 0
2-(1,1-DIMETHYLETHYL)9-FLUORO-3,6-DIHYDRO-7H-BENZ[H]-IMIDAZ[4,5-F]ISOQUINOLIN-7-ONE Experimental Pharma Target 0
4-(6-{[(1R)-1-(hydroxymethyl)propyl]amino}imidazo[1,2-b]pyridazin-3-yl)benzoic acid Experimental Pharma Target 0
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for DAPK3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for DAPK3 Gene

Compound Action Cas Number
DAPK Substrate Peptide Synthetic peptide substrate for DAPK 386769-53-5
genes like me logo Genes that share compounds with DAPK3: view

Drug Products

Transcripts for DAPK3 Gene

Unigene Clusters for DAPK3 Gene

Death-associated protein kinase 3:
Representative Sequences:

Clone Products

  • Addgene plasmids for DAPK3

Alternative Splicing Database (ASD) splice patterns (SP) for DAPK3 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9a · 9b
SP1: - -
SP2: - -
SP3:
SP4:

Relevant External Links for DAPK3 Gene

GeneLoc Exon Structure for
DAPK3
ECgene alternative splicing isoforms for
DAPK3

Expression for DAPK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DAPK3 Gene

Protein differential expression in normal tissues from HIPED for DAPK3 Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (12.8), CD4 Tcells (7.4), and Gallbladder (7.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DAPK3 Gene



NURSA nuclear receptor signaling pathways regulating expression of DAPK3 Gene:

DAPK3

SOURCE GeneReport for Unigene cluster for DAPK3 Gene:

Hs.631844

mRNA Expression by UniProt/SwissProt for DAPK3 Gene:

O43293-DAPK3_HUMAN
Tissue specificity: Widely expressed. Isoform 1 and isoform 2 are expressed in the bladder smooth muscle.

Evidence on tissue expression from TISSUES for DAPK3 Gene

  • Nervous system(4.6)
  • Muscle(2.8)
  • Heart(2.1)
genes like me logo Genes that share expression patterns with DAPK3: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for DAPK3 Gene

Orthologs for DAPK3 Gene

This gene was present in the common ancestor of animals.

Orthologs for DAPK3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DAPK3 33 34
  • 99.41 (n)
oppossum
(Monodelphis domestica)
Mammalia DAPK3 34
  • 91 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia DAPK3 34
  • 90 (a)
OneToOne
dog
(Canis familiaris)
Mammalia DAPK3 33 34
  • 89.79 (n)
cow
(Bos Taurus)
Mammalia DAPK3 33 34
  • 88.47 (n)
mouse
(Mus musculus)
Mammalia Dapk3 33 16 34
  • 82.22 (n)
rat
(Rattus norvegicus)
Mammalia Dapk3 33
  • 81.47 (n)
chicken
(Gallus gallus)
Aves DAPK3 33 34
  • 81.94 (n)
tropical clawed frog
(Silurana tropicalis)
Amphibia dapk3 33
  • 68.82 (n)
zebrafish
(Danio rerio)
Actinopterygii dapk3 33 34
  • 74.92 (n)
worm
(Caenorhabditis elegans)
Secernentea dapk-1 34
  • 12 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 44 (a)
OneToMany
Species where no ortholog for DAPK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • lizard (Anolis carolinensis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DAPK3 Gene

ENSEMBL:
Gene Tree for DAPK3 (if available)
TreeFam:
Gene Tree for DAPK3 (if available)

Paralogs for DAPK3 Gene

Variants for DAPK3 Gene

Sequence variations from dbSNP and Humsavar for DAPK3 Gene

SNP ID Clin Chr 19 pos Variation AA Info Type
VAR_040438 A colorectal adenocarcinoma sample p.Thr112Met
VAR_040439 An ovarian mucinous carcinoma sample p.Asp161Asn
VAR_040440 A lung neuroendocrine carcinoma sample p.Pro216Ser
rs1000269403 -- 3,968,851(-) C/T intron_variant
rs1000905398 -- 3,968,726(-) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for DAPK3 Gene

Variant ID Type Subtype PubMed ID
esv2675149 CNV deletion 23128226
nsv833715 CNV loss 17160897
nsv953949 CNV deletion 24416366

Variation tolerance for DAPK3 Gene

Residual Variation Intolerance Score: 47.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.62; 31.19% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for DAPK3 Gene

Human Gene Mutation Database (HGMD)
DAPK3
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DAPK3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DAPK3 Gene

Disorders for DAPK3 Gene

MalaCards: The human disease database

(1) MalaCards diseases for DAPK3 Gene - From: HGMD and GeneCards

Disorder Aliases PubMed IDs
recessive dystrophic epidermolysis bullosa
  • autosomal recessive dystrophic epidermolysis bullosa generalisata gravis
- elite association - COSMIC cancer census association via MalaCards
Search DAPK3 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for DAPK3

genes like me logo Genes that share disorders with DAPK3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DAPK3 Gene

Publications for DAPK3 Gene

  1. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. (PMID: 9488481) Kawai T … Akira S (Molecular and cellular biology 1998) 2 3 4 22 58
  2. ZIP kinase plays a crucial role in androgen receptor-mediated transcription. (PMID: 18084323) Leister P … Scheidtmann KH (Oncogene 2008) 3 4 22 58
  3. Novel ZIP kinase isoform lacks leucine zipper. (PMID: 17126281) Takamoto N … Ikebe M (Archives of biochemistry and biophysics 2006) 3 4 22 58
  4. TCP10L is expressed specifically in spermatogenic cells and binds to death associated protein kinase-3. (PMID: 15910542) Yu H … Yu L (International journal of andrology 2005) 3 4 22 58
  5. ZIP kinase triggers apoptosis from nuclear PML oncogenic domains. (PMID: 12917339) Kawai T … Reed JC (Molecular and cellular biology 2003) 3 4 22 58

Products for DAPK3 Gene

Sources for DAPK3 Gene

Content
Loading form....