Free for academic non-profit institutions. Other users need a Commercial license

Aliases for DAPK1 Gene

Aliases for DAPK1 Gene

  • Death Associated Protein Kinase 1 2 3 5
  • Death-Associated Protein Kinase 1 2 3
  • DAP Kinase 1 3 4
  • EC 2.7.11.1 4 61
  • DAPK 3 4
  • EC 2.7.11 61
  • ROCO3 3

External Ids for DAPK1 Gene

Previous GeneCards Identifiers for DAPK1 Gene

  • GC09P081156
  • GC09P081966
  • GC09P083667
  • GC09P085569
  • GC09P087342
  • GC09P089301
  • GC09P090112
  • GC09P059938

Summaries for DAPK1 Gene

Entrez Gene Summary for DAPK1 Gene

  • Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

GeneCards Summary for DAPK1 Gene

DAPK1 (Death Associated Protein Kinase 1) is a Protein Coding gene. Diseases associated with DAPK1 include Pediatric Lymphoma and Cervical Squamous Cell Carcinoma. Among its related pathways are Apoptosis and Autophagy and Dimerization of procaspase-8. GO annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is DAPK3.

UniProtKB/Swiss-Prot for DAPK1 Gene

  • Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.

  • Isoform 2 cannot induce apoptosis but can induce membrane blebbing.

Tocris Summary for DAPK1 Gene

Gene Wiki entry for DAPK1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for DAPK1 Gene

Genomics for DAPK1 Gene

Regulatory Elements for DAPK1 Gene

Enhancers for DAPK1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH09G087554 1.7 FANTOM5 Ensembl ENCODE dbSUPER 27 +58.5 58485 3.4 HDAC1 FOXA2 ATF1 YY1 RARA CREM MIXL1 CEBPB ZEB2 NFIL3 DAPK1 CTSL DAPK1-IT1 GC09P087601
GH09G087568 1.5 Ensembl ENCODE dbSUPER 22.5 +73.3 73319 4.4 HNRNPUL1 FOXA2 ATF1 MLX ZFP64 ARID4B FEZF1 DMAP1 ZNF48 YY1 DAPK1 DAPK1-IT1 GC09P087601
GH09G087611 1.8 FANTOM5 Ensembl ENCODE dbSUPER 17.5 +116.0 116047 3.9 HNRNPUL1 FOXA2 MLX DMAP1 ZNF48 YY1 ZNF143 FOS SP5 MXD4 DAPK1 CTSL GC09P087601 GC09P087714
GH09G087518 1.5 Ensembl ENCODE dbSUPER 20.4 +22.4 22357 2.5 PKNOX1 ATF1 ARNT TCF12 ZNF766 ELK1 GATA2 NCOA1 ZNF592 MBD2 DAPK1 RPS29P18
GH09G087592 1.9 FANTOM5 Ensembl ENCODE dbSUPER 15 +100.0 100018 10.3 FOXA2 FEZF1 ZNF2 YY1 TCF12 GTF3C2 GATA2 FOS ZNF263 JUNB DAPK1 CTSL GC09P087601 DAPK1-IT1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around DAPK1 on UCSC Golden Path with GeneCards custom track

Promoters for DAPK1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000237260 1672 3401 FOXA2 AGO1 ARID4B SIN3A DMAP1 ZNF48 YY1 GLIS2 FOS KLF13

Genomic Location for DAPK1 Gene

Chromosome:
9
Start:
87,497,228 bp from pter
End:
87,708,634 bp from pter
Size:
211,407 bases
Orientation:
Plus strand

Genomic View for DAPK1 Gene

Genes around DAPK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
DAPK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for DAPK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for DAPK1 Gene

Proteins for DAPK1 Gene

  • Protein details for DAPK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P53355-DAPK1_HUMAN
    Recommended name:
    Death-associated protein kinase 1
    Protein Accession:
    P53355
    Secondary Accessions:
    • B7ZLD2
    • B7ZLE7
    • Q14CQ7
    • Q1W5W0
    • Q68CP8
    • Q6ZRZ3
    • Q9BTL8

    Protein attributes for DAPK1 Gene

    Size:
    1430 amino acids
    Molecular mass:
    160046 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with KLHL20. Interacts (via death domain) with MAPK1 and MAPK3. Interacts with MAP1B (via N-terminus). Interacts (via death domain) with UNC5B (via death domain). Interacts with PRKD1 in an oxidative stress-regulated manner. Interacts with PIN1, PDCD6, BECN1, GRINB, TSC2 and STX1A. Interacts (via kinase domain) with DAPK3 (via kinase domain).
    SequenceCaution:
    • Sequence=AAP35581.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Sequence of unknown origin in the C-terminal part.; Evidence={ECO:0000305}; Sequence=CAA53712.1; Type=Frameshift; Positions=462, 464; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for DAPK1 Gene

    Alternative splice isoforms for DAPK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for DAPK1 Gene

Selected DME Specific Peptides for DAPK1 Gene

P53355:
  • GVITYILL
  • EFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILL
  • IRRLLVKD
  • GGELFDFLAEKESLTE
  • GDTKQET
  • GEELGSGQFA
  • GTPEFVAPE
  • IAHFDLKPENIMLLD
  • IIDFGLA

Post-translational modifications for DAPK1 Gene

  • In response to mitogenic stimulation (PMA or EGF), phosphorylated at Ser-289; phosphorylation suppresses DAPK1 pro-apoptotic function. Autophosphorylation at Ser-308 inhibits its catalytic activity. Phosphorylation at Ser-734 by MAPK1 increases its catalytic activity and promotes cytoplasmic retention of MAPK1. Endoplasmic-stress can cause dephosphorylation at Ser-308.
  • Removal of the C-terminal tail of isoform 2 (corresponding to amino acids 296-337 of isoform 2) by proteolytic cleavage stimulates maximally its membrane-blebbing function.
  • Ubiquitinated by the BCR(KLHL20) E3 ubiquitin ligase complex, leading to its degradation by the proteasome.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for DAPK1 (DAPK1)

Domains & Families for DAPK1 Gene

Suggested Antigen Peptide Sequences for DAPK1 Gene

Graphical View of Domain Structure for InterPro Entry

P53355

UniProtKB/Swiss-Prot:

DAPK1_HUMAN :
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
Domain:
  • The autoinhibitory domain sterically blocks the substrate peptide-binding site by making both hydrophobic and electrostatic contacts with the kinase core.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
genes like me logo Genes that share domains with DAPK1: view

Function for DAPK1 Gene

Molecular function for DAPK1 Gene

GENATLAS Biochemistry:
DAP kinase,160kDa,coupling the control of apoptosis to metastasis,triggered by IFNG,localized to the actin microfilament network
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Regulated by a locking mechanism, involving autophosphorylation at Ser-308 and calmodulin binding. In the inactive state, Ser-308 is phosphorylated. Activation involves its dephosphorylation and a release-of-autoinhibition mechanism where binding of calmodulin induces a conformational change that relieves the steric block of the active site by the autoinhibitory domain. Activity is modulated by UNC5B and NTN1. UNC5B activates it by inhibiting the phosphorylation at Ser-308, whereas NTN1 inhibits UNC5B-mediated activation of DAPK1. Endoplasmic-stress activates by causing Ser-308 dephosphorylation.
UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell deaths signal, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Phosphorylates PIN1 resulting in inhibition of its catalytic activity, nuclear localization, and cellular function. Phosphorylates TPM1, enhancing stress fiber formation in endothelial cells. Phosphorylates STX1A and significantly decreases its binding to STXBP1. Phosphorylates PRKD1 and regulates JNK signaling by binding and activating PRKD1 under oxidative stress. Phosphorylates BECN1, reducing its interaction with BCL2 and BCL2L1 and promoting the induction of autophagy. Phosphorylates TSC2, disrupting the TSC1-TSC2 complex and stimulating mTORC1 activity in a growth factor-dependent pathway. Phosphorylates RPS6, MYL9 and DAPK3. Acts as a signaling amplifier of NMDA receptors at extrasynaptic sites for mediating brain damage in stroke. Cerebral ischemia recruits DAPK1 into the NMDA receptor complex and it phosphorylates GRINB at Ser-1303 inducing injurious Ca(2+) influx through NMDA receptor channels, resulting in an irreversible neuronal death. Required together with DAPK3 for phosphorylation of RPL13A upon interferon-gamma activation which is causing RPL13A involvement in transcript-selective translation inhibition.
UniProtKB/Swiss-Prot Function:
Isoform 2 cannot induce apoptosis but can induce membrane blebbing.
UniProtKB/Swiss-Prot Induction:
Up-regulated following treatment with IFNG/IFN-gamma.

Enzyme Numbers (IUBMB) for DAPK1 Gene

Gene Ontology (GO) - Molecular Function for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IDA 7828849
GO:0004674 protein serine/threonine kinase activity TAS 16756490
GO:0004683 calmodulin-dependent protein kinase activity IDA 10629061
GO:0005515 protein binding IPI 15616583
GO:0005516 calmodulin binding IEA,IDA 10629061
genes like me logo Genes that share ontologies with DAPK1: view
genes like me logo Genes that share phenotypes with DAPK1: view

Animal Models for DAPK1 Gene

MGI Knock Outs for DAPK1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DAPK1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for DAPK1 Gene

Localization for DAPK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for DAPK1 Gene

Isoform 1: Cytoplasm. Cytoplasm, cytoskeleton. Note=Colocalizes with MAP1B in the microtubules and cortical actin fibers.
Isoform 2: Cytoplasm. Cytoplasm, cytoskeleton.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for DAPK1 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
cytosol 4
extracellular 1
mitochondrion 1
nucleus 1

Gene Ontology (GO) - Cellular Components for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IDA,IEA 12730201
GO:0005856 cytoskeleton IEA --
GO:0005886 plasma membrane IDA 12730201
GO:0015629 actin cytoskeleton IDA 10629061
genes like me logo Genes that share ontologies with DAPK1: view

Pathways & Interactions for DAPK1 Gene

genes like me logo Genes that share pathways with DAPK1: view

Pathways by source for DAPK1 Gene

2 Sino Biological pathways for DAPK1 Gene
1 Cell Signaling Technology pathway for DAPK1 Gene
2 BioSystems pathways for DAPK1 Gene

SIGNOR curated interactions for DAPK1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for DAPK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation TAS 16756490
GO:0006915 apoptotic process IGI,IMP 10629061
GO:0007165 signal transduction IEA --
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors IEA --
genes like me logo Genes that share ontologies with DAPK1: view

Drugs & Compounds for DAPK1 Gene

(12) Drugs for DAPK1 Gene - From: DrugBank, PharmGKB, ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Gemcitabine Approved Pharma Ribonucleotide reductase and DNA synthesis inhibitor, Nucleoside Analogs 2018
5,6-Dihydro-Benzo[H]Cinnolin-3-Ylamine Experimental Pharma Target 0
6-(3-AMINOPROPYL)-4,9-DIMETHYLPYRROLO[3,4-C]CARBAZOLE-1,3(2H,6H)-DIONE Experimental Pharma Target 0
Phosphoaminophosphonic Acid-Adenylate Ester Experimental Pharma Target 0
TC-DAPK 6 Pharma DAPK inhibitor, Potent and selective inhibitor of DAPK1 0

(6) Additional Compounds for DAPK1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(1) Tocris Compounds for DAPK1 Gene

Compound Action Cas Number
TC-DAPK 6 Potent and selective inhibitor of DAPK1

(2) ApexBio Compounds for DAPK1 Gene

Compound Action Cas Number
DAPK Substrate Peptide Synthetic peptide substrate for DAPK 386769-53-5
TC-DAPK 6 DAPK inhibitor 315694-89-4
genes like me logo Genes that share compounds with DAPK1: view

Drug Products

Transcripts for DAPK1 Gene

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for DAPK1

Alternative Splicing Database (ASD) splice patterns (SP) for DAPK1 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^
SP1: - - - -
SP2:
SP3: - -
SP4:
SP5: - -
SP6: - - - -
SP7:
SP8: -

ExUns: 22a · 22b ^ 23 ^ 24 ^ 25 ^ 26a · 26b ^ 27a · 27b ^ 28 ^ 29
SP1: - - -
SP2:
SP3:
SP4: - -
SP5:
SP6:
SP7:
SP8:

Relevant External Links for DAPK1 Gene

GeneLoc Exon Structure for
DAPK1
ECgene alternative splicing isoforms for
DAPK1

Expression for DAPK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for DAPK1 Gene

Protein differential expression in normal tissues from HIPED for DAPK1 Gene

This gene is overexpressed in Placenta (46.6) and Fetal Brain (11.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for DAPK1 Gene



Protein tissue co-expression partners for DAPK1 Gene

NURSA nuclear receptor signaling pathways regulating expression of DAPK1 Gene:

DAPK1

SOURCE GeneReport for Unigene cluster for DAPK1 Gene:

Hs.380277

mRNA Expression by UniProt/SwissProt for DAPK1 Gene:

P53355-DAPK1_HUMAN
Tissue specificity: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas.

Evidence on tissue expression from TISSUES for DAPK1 Gene

  • Nervous system(4.7)
  • Liver(4.3)
  • Lung(2.5)
  • Stomach(2)
genes like me logo Genes that share expression patterns with DAPK1: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for DAPK1 Gene

Orthologs for DAPK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for DAPK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia DAPK1 34 35
  • 99.21 (n)
oppossum
(Monodelphis domestica)
Mammalia DAPK1 35
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia DAPK1 34 35
  • 90.77 (n)
dog
(Canis familiaris)
Mammalia DAPK1 34 35
  • 89.77 (n)
mouse
(Mus musculus)
Mammalia Dapk1 34 16 35
  • 87.67 (n)
rat
(Rattus norvegicus)
Mammalia Dapk1 34
  • 87.6 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia DAPK1 35
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves DAPK1 34 35
  • 78.55 (n)
lizard
(Anolis carolinensis)
Reptilia DAPK1 35
  • 89 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia dapk1 34
  • 74.7 (n)
zebrafish
(Danio rerio)
Actinopterygii dapk1 34 35
  • 68.86 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG1776 36
  • 43 (a)
worm
(Caenorhabditis elegans)
Secernentea dapk-1 34 35
  • 46.21 (n)
ZC373.4 36
  • 38 (a)
K12C11.4 36
  • 34 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes MBP1 37
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 46 (a)
OneToMany
Species where no ortholog for DAPK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for DAPK1 Gene

ENSEMBL:
Gene Tree for DAPK1 (if available)
TreeFam:
Gene Tree for DAPK1 (if available)

Paralogs for DAPK1 Gene

Paralogs for DAPK1 Gene

Pseudogenes.org Pseudogenes for DAPK1 Gene

genes like me logo Genes that share paralogs with DAPK1: view

Variants for DAPK1 Gene

Sequence variations from dbSNP and Humsavar for DAPK1 Gene

SNP ID Clin Chr 09 pos Sequence Context AA Info Type
rs1000007182 -- 87,616,223(+) GAAGC(C/G)TAGGA intron-variant
rs1000011535 -- 87,531,022(+) TACCC(C/T)TTGGA intron-variant
rs1000047119 -- 87,581,928(+) TAAGA(C/T)ATTTT intron-variant
rs1000048990 -- 87,512,184(+) TCCTG(A/C)ATAGC intron-variant
rs1000061099 -- 87,630,486(+) CCCCT(G/T)GTCCT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for DAPK1 Gene

Variant ID Type Subtype PubMed ID
esv1009206 CNV deletion 20482838
esv1024641 CNV deletion 17803354
esv1345777 CNV deletion 17803354
esv1463209 CNV deletion 17803354
esv21629 CNV loss 19812545
esv22121 CNV gain 19812545
esv2738708 CNV deletion 23290073
esv2738709 CNV deletion 23290073
esv2759703 CNV loss 17122850
esv28714 CNV loss 19812545
esv3342753 CNV duplication 20981092
esv3620981 CNV loss 21293372
esv3620983 CNV loss 21293372
nsv1053574 CNV gain 25217958
nsv1077558 CNV duplication 25765185
nsv1147663 CNV duplication 26484159
nsv1161881 CNV duplication 26073780
nsv1161882 CNV duplication 26073780
nsv474751 CNV novel sequence insertion 20440878
nsv478259 CNV novel sequence insertion 20440878
nsv8545 CNV gain 18304495
nsv957764 CNV deletion 24416366
nsv972772 CNV duplication 23825009

Variation tolerance for DAPK1 Gene

Residual Variation Intolerance Score: 2.22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.52; 71.94% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for DAPK1 Gene

Human Gene Mutation Database (HGMD)
DAPK1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
DAPK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for DAPK1 Gene

Disorders for DAPK1 Gene

MalaCards: The human disease database

(12) MalaCards diseases for DAPK1 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
pediatric lymphoma
  • childhood lymphoma
cervical squamous cell carcinoma
  • squamous cell carcinoma of cervix
triple-receptor negative breast cancer
cervical cancer, somatic
  • cervical cancer
cholecystitis
  • acute and chronic cholecystitis
- elite association - COSMIC cancer census association via MalaCards
Search DAPK1 in MalaCards View complete list of genes associated with diseases

Relevant External Links for DAPK1

Genetic Association Database (GAD)
DAPK1
Human Genome Epidemiology (HuGE) Navigator
DAPK1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
DAPK1
genes like me logo Genes that share disorders with DAPK1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for DAPK1 Gene

Publications for DAPK1 Gene

  1. The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses. (PMID: 20389280) Lee Y.R. … Chen R.H. (EMBO J. 2010) 3 4 22 64
  2. DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and induction of autophagy. (PMID: 19180116) Zalckvar E. … Kimchi A. (EMBO Rep. 2009) 3 4 22 64
  3. An alternative transcript from the death-associated protein kinase 1 locus encoding a small protein selectively mediates membrane blebbing. (PMID: 18422656) Lin Y. … Hupp T. (FEBS J. 2008) 3 4 22 64
  4. Control of death-associated protein kinase (DAPK) activity by phosphorylation and proteasomal degradation. (PMID: 17056602) Jin Y. … Gallagher P.J. (J. Biol. Chem. 2006) 3 4 22 64
  5. Bidirectional signals transduced by DAPK-ERK interaction promote the apoptotic effect of DAPK. (PMID: 15616583) Chen C.H. … Chen R.H. (EMBO J. 2005) 3 4 22 64

Products for DAPK1 Gene

  • Addgene plasmids for DAPK1

Sources for DAPK1 Gene

Content
Loading form....