Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CYP51A1 Gene

Aliases for CYP51A1 Gene

  • Cytochrome P450 Family 51 Subfamily A Member 1 2 3 5
  • Cytochrome P450, Family 51, Subfamily A, Polypeptide 1 2 3
  • Cytochrome P450, 51 (Lanosterol 14-Alpha-Demethylase) 2 3
  • Sterol 14-Alpha Demethylase 3 4
  • Cytochrome P450 51A1 3 4
  • Cytochrome P450-14DM 3 4
  • Cytochrome P45014DM 3 4
  • Cytochrome P450LI 3 4
  • EC 1.14.13.70 4 61
  • CYP51 3 4
  • CYPLI 3 4
  • LDM 3 4
  • Lanosterol 14-Alpha Demethylase 3
  • P450-14DM 3
  • P450L1 3
  • CYPL1 3
  • CP51 3

External Ids for CYP51A1 Gene

Previous HGNC Symbols for CYP51A1 Gene

  • CYP51

Previous GeneCards Identifiers for CYP51A1 Gene

  • GC07M090277
  • GC07M091339
  • GC07M091354
  • GC07M091355
  • GC07M091387
  • GC07M091579
  • GC07M091741
  • GC07M086348

Summaries for CYP51A1 Gene

Entrez Gene Summary for CYP51A1 Gene

  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

GeneCards Summary for CYP51A1 Gene

CYP51A1 (Cytochrome P450 Family 51 Subfamily A Member 1) is a Protein Coding gene. Diseases associated with CYP51A1 include Antley-Bixler Syndrome and Chagas Disease. Among its related pathways are cholesterol biosynthesis I and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP26C1.

UniProtKB/Swiss-Prot for CYP51A1 Gene

  • Catalyzes C14-demethylation of lanosterol; it transforms lanosterol into 4,4-dimethyl cholesta-8,14,24-triene-3-beta-ol.

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CYP51A1 Gene

Genomics for CYP51A1 Gene

Regulatory Elements for CYP51A1 Gene

Enhancers for CYP51A1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07G092178 1 ENCODE 42 -36.3 -36258 1.5 ARID4B SIN3A DMAP1 ZNF2 ZNF48 YY1 GLIS2 ZNF143 ZNF263 KAT8 CYP51A1 ERVW-1 KRIT1 LRRD1
GH07G092132 1.2 ENCODE 24.9 +8.5 8533 3.9 CREB3L1 AGO1 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3 NFYC CYP51A1 ENSG00000243107 GATAD1 KRIT1 CYP51A1-AS1 GC07P092082
GH07G092177 0.6 ENCODE 42.5 -34.7 -34682 1.0 PKNOX1 PRDM6 JUND PBX2 FOS PRDM1 SP7 CYP51A1 ERVW-1 LRRD1
GH07G091939 1.1 ENCODE 22.5 +201.8 201790 3.0 HDGF PKNOX1 MLX CREB3L1 ARNT WRNIP1 ARID4B SIN3A DMAP1 ZNF2 CYP51A1 GC07M091897 AKAP9
GH07G092041 0.9 ENCODE 26.6 +99.2 99220 5.4 FOXA2 MLX ARID4B DMAP1 YY1 SP5 PPARG KAT8 MEF2D MIER3 CYP51A1 PIR39118 GC07P092060
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CYP51A1 on UCSC Golden Path with GeneCards custom track

Genomic Location for CYP51A1 Gene

Chromosome:
7
Start:
92,112,149 bp from pter
End:
92,142,952 bp from pter
Size:
30,804 bases
Orientation:
Minus strand

Genomic View for CYP51A1 Gene

Genes around CYP51A1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CYP51A1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CYP51A1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CYP51A1 Gene

Proteins for CYP51A1 Gene

  • Protein details for CYP51A1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q16850-CP51A_HUMAN
    Recommended name:
    Lanosterol 14-alpha demethylase
    Protein Accession:
    Q16850
    Secondary Accessions:
    • A4D1F8
    • B2RAI4
    • B4DJ55
    • O00770
    • O00772
    • Q16784
    • Q8N1A8
    • Q99868

    Protein attributes for CYP51A1 Gene

    Size:
    503 amino acids
    Molecular mass:
    56806 Da
    Cofactor:
    Name=heme; Xref=ChEBI:CHEBI:30413;
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAB39951.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=AAB46356.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=AAH32322.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAA09512.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAG36881.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=EAL24154.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=EAW76858.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for CYP51A1 Gene

    Alternative splice isoforms for CYP51A1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CYP51A1 Gene

Selected DME Specific Peptides for CYP51A1 Gene

Q16850:
  • AAALLFNSKNEDLNAE
  • QHVSIIEKETKEYF
  • RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRD
  • LTTPVFG
  • VFLEQKK
  • TPVFGKGV
  • AYEKYGPVFSFTMVGKTFTYLLGS
  • PFGAGRHRC
  • GMLIGLLLAGQHTSSTTSAWMGFFLA
  • GENFAYVQIKTIWSTMLRLYEFDLI

Post-translational modifications for CYP51A1 Gene

  • Ubiquitination at isoforms=2141, isoforms=2160, Lys261, isoforms=2266, and isoforms=2436
  • Modification sites at PhosphoSitePlus

Other Protein References for CYP51A1 Gene

Domains & Families for CYP51A1 Gene

Gene Families for CYP51A1 Gene

Suggested Antigen Peptide Sequences for CYP51A1 Gene

Graphical View of Domain Structure for InterPro Entry

Q16850

UniProtKB/Swiss-Prot:

CP51A_HUMAN :
  • Belongs to the cytochrome P450 family.
Family:
  • Belongs to the cytochrome P450 family.
genes like me logo Genes that share domains with CYP51A1: view

Function for CYP51A1 Gene

Molecular function for CYP51A1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
A 14-alpha-methylsteroid + 3 O(2) + 3 NADPH = a Delta(14)-steroid + formate + 3 NADP(+) + 4 H(2)O.
UniProtKB/Swiss-Prot Function:
Catalyzes C14-demethylation of lanosterol; it transforms lanosterol into 4,4-dimethyl cholesta-8,14,24-triene-3-beta-ol.

Enzyme Numbers (IUBMB) for CYP51A1 Gene

Gene Ontology (GO) - Molecular Function for CYP51A1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005506 iron ion binding IEA --
GO:0008398 sterol 14-demethylase activity TAS --
GO:0016491 oxidoreductase activity IEA --
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen IEA --
GO:0020037 heme binding IDA,IEA 20149798
genes like me logo Genes that share ontologies with CYP51A1: view
genes like me logo Genes that share phenotypes with CYP51A1: view

Animal Models for CYP51A1 Gene

MGI Knock Outs for CYP51A1:

Animal Model Products

  • Taconic Biosciences Mouse Models for CYP51A1

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CYP51A1 Gene

Localization for CYP51A1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for CYP51A1 Gene

Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CYP51A1 gene
Compartment Confidence
endoplasmic reticulum 5
plasma membrane 4
extracellular 2
mitochondrion 2
peroxisome 1
nucleus 1
cytosol 1
lysosome 1
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for CYP51A1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IDA --
GO:0005789 endoplasmic reticulum membrane TAS --
GO:0005886 plasma membrane IBA --
GO:0016020 membrane IDA,IEA 19946888
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with CYP51A1: view

Pathways & Interactions for CYP51A1 Gene

genes like me logo Genes that share pathways with CYP51A1: view

UniProtKB/Swiss-Prot Q16850-CP51A_HUMAN

  • Pathway: Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 1/6.

Gene Ontology (GO) - Biological Process for CYP51A1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006694 steroid biosynthetic process IDA,IEA 20149798
GO:0006695 cholesterol biosynthetic process TAS --
GO:0008202 steroid metabolic process IEA --
GO:0008203 cholesterol metabolic process IEA --
genes like me logo Genes that share ontologies with CYP51A1: view

No data available for SIGNOR curated interactions for CYP51A1 Gene

Drugs & Compounds for CYP51A1 Gene

(25) Drugs for CYP51A1 Gene - From: DrugBank, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Itraconazole Approved, Investigational Pharma Target, inhibitor SMO antagonist; acts at different binding site to cyclopamine (Cat No. 1623) 158
Sertaconazole Approved Pharma Enzyme, inhibitor 2
Tioconazole Approved Pharma Target, inhibitor 0
Ketoconazole Approved, Investigational Pharma Pore Blocker, Enzyme, inhibitor Inhibitor of cyclosporine oxidase and testosterone 6 beta-hydroxylase, Cytochrome P450c17 inhibitor 175
Posaconazole Approved, Investigational, Vet_approved Pharma Sterol C14ɑ demethylase inhibitor 56

(22) Additional Compounds for CYP51A1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
nadph
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) Adenosine 5'-ester with 1,4-dihydro-1-b-D-ribofuranosylnicotinamide
  • 2'-(Dihydrogen phosphate) 5'-(trihydrogen pyrophosphate) Adenosine 5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosylnicotinamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) P'-5'-ester with 1,4-dihydro-1-beta-D-ribofuranosyl-3-pyridinecarboxamide
  • Adenosine 5'-(trihydrogen diphosphate) 2'-(dihydrogen phosphate) P'-5'-ester with 1,4-dihydro-1-beta-delta-ribofuranosyl-3-pyridinecarboxamide
  • b-NADPH
53-57-6
obtusifoliol
  • 4,4-Dimethyl-14a-hydroxymethyl-5a-cholesta-8,24-dien-3b-ol
  • 4,4-Dimethyl-14alpha-hydroxymethyl-5alpha-cholesta-8,24-dien-3beta-ol
4,4-Dimethylcholesta-8,14,24-trienol
  • (3beta,5alpha)-4,4-dimethyl-Cholesta-8,14,24-trien-3-ol
  • (3beta,5alpha)-4,4-Dimethylcholesta-8,14,24-trien-3-ol
  • 4,4'-Dimethyl cholesta-8,14,24-triene-3-beta-ol
  • 4,4-Dimechol-8,14,24-trienol
  • 4,4-Dimethyl-5-alpha-cholesta-8,14,24-trien-3-beta-ol
64284-64-6
Delta 8,14 -Sterol
  • 4-alpha-Methyl-5-alpha-ergosta-8,14,24(28)-trien-3-beta-ol
  • 4a-Methyl-5a-ergosta-8,14,24(28)-trien-3b-ol
  • 4a-Methylergosta-8,14,24(241)-trien-3b-ol
  • 4alpha-Methyl-5alpha-ergosta-8,14,24(28)-trien-3beta-ol
  • delta 8,14 -Sterol
74635-33-9
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton

(4) ApexBio Compounds for CYP51A1 Gene

Compound Action Cas Number
Posaconazole Sterol C14ɑ demethylase inhibitor 171228-49-2
Posaconazole hydrate C14ɑ demethylase inhibitor 1198769-38-8
Voriconazole CYP51 inhibitor 137234-62-9
YM 511 148869-05-0
genes like me logo Genes that share compounds with CYP51A1: view

Transcripts for CYP51A1 Gene

Unigene Clusters for CYP51A1 Gene

Cytochrome P450, family 51, subfamily A, polypeptide 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for CYP51A1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11 ^ 12a · 12b · 12c
SP1: -
SP2: -
SP3:
SP4:

Relevant External Links for CYP51A1 Gene

GeneLoc Exon Structure for
CYP51A1
ECgene alternative splicing isoforms for
CYP51A1

Expression for CYP51A1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CYP51A1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for CYP51A1 Gene

This gene is overexpressed in Fetal testis (25.0), Bone (11.7), Fetal Liver (9.1), and Adrenal (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CYP51A1 Gene



Protein tissue co-expression partners for CYP51A1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of CYP51A1 Gene:

CYP51A1

SOURCE GeneReport for Unigene cluster for CYP51A1 Gene:

Hs.417077

mRNA Expression by UniProt/SwissProt for CYP51A1 Gene:

Q16850-CP51A_HUMAN
Tissue specificity: Ubiquitously expressed with highest levels in testis, ovary, adrenal, prostate, liver, kidney and lung.

Evidence on tissue expression from TISSUES for CYP51A1 Gene

  • Nervous system(4.9)
  • Liver(4.6)
  • Lung(2.4)
  • Kidney(2.2)
  • Adrenal gland(2.1)
  • Heart(2.1)
  • Intestine(2.1)
genes like me logo Genes that share expression patterns with CYP51A1: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CYP51A1 Gene

Orthologs for CYP51A1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for CYP51A1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CYP51A1 34 35
  • 99.67 (n)
dog
(Canis familiaris)
Mammalia CYP51A1 34 35
  • 92.48 (n)
cow
(Bos Taurus)
Mammalia CYP51A1 34 35
  • 91.15 (n)
mouse
(Mus musculus)
Mammalia Cyp51 34 16 35
  • 88.53 (n)
rat
(Rattus norvegicus)
Mammalia Cyp51 34
  • 87.06 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia CYP51A1 35
  • 85 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia CYP51A1 35
  • 81 (a)
OneToOne
chicken
(Gallus gallus)
Aves -- 35
  • 85 (a)
OneToMany
CYP51A1 34 35
  • 76.73 (n)
lizard
(Anolis carolinensis)
Reptilia CYP51A1 35
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia cyp51a1 34
  • 71.87 (n)
Str.7211 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.25369 34
zebrafish
(Danio rerio)
Actinopterygii cyp51 34 35
  • 69.19 (n)
wufb66a09 34
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E03653g 34
  • 49.09 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ERG11 34 35 37
  • 48.53 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_ADR162W 34
  • 48.19 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons CYP51G1 34
  • 48.16 (n)
rice
(Oryza sativa)
Liliopsida Os11g0525200 34
  • 46.42 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes erg11 34
  • 49.19 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 12 (a)
ManyToMany
Species where no ortholog for CYP51A1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for CYP51A1 Gene

ENSEMBL:
Gene Tree for CYP51A1 (if available)
TreeFam:
Gene Tree for CYP51A1 (if available)

Paralogs for CYP51A1 Gene

Paralogs for CYP51A1 Gene

Pseudogenes.org Pseudogenes for CYP51A1 Gene

genes like me logo Genes that share paralogs with CYP51A1: view

Variants for CYP51A1 Gene

Sequence variations from dbSNP and Humsavar for CYP51A1 Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs1000189717 -- 92,128,324(+) ACCCA(C/T)TACTT intron-variant
rs1000284599 -- 92,128,018(+) TGTTC(C/T)ATATC intron-variant
rs1000457167 -- 92,114,277(+) ATATA(C/T)TAAAA intron-variant
rs1000488498 -- 92,134,605(+) GATAG(A/G)GCACC intron-variant, nc-transcript-variant, upstream-variant-2KB
rs1000539717 -- 92,121,061(+) AAGGC(A/G)GGCAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for CYP51A1 Gene

Variant ID Type Subtype PubMed ID
esv3306173 CNV mobile element insertion 20981092
esv3308042 CNV mobile element insertion 20981092
esv3372054 CNV insertion 20981092
esv3571987 CNV loss 25503493
nsv1021101 CNV gain 25217958
nsv1109898 CNV deletion 24896259
nsv5839 CNV insertion 18451855
nsv966859 CNV duplication 23825009

Variation tolerance for CYP51A1 Gene

Residual Variation Intolerance Score: 25.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.79; 33.77% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CYP51A1 Gene

Human Gene Mutation Database (HGMD)
CYP51A1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CYP51A1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CYP51A1 Gene

Disorders for CYP51A1 Gene

MalaCards: The human disease database

(4) MalaCards diseases for CYP51A1 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
antley-bixler syndrome
  • trapezoidocephaly-synostosis syndrome
chagas disease
  • american trypanosomiasis
antley-bixler syndrome without genital anomalies or disordered steroidogenesis
  • trapezoidocephaly-synotsosis syndrome
parasitic protozoa infectious disease
  • mastigophora infectious disease
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for CYP51A1

Genetic Association Database (GAD)
CYP51A1
Human Genome Epidemiology (HuGE) Navigator
CYP51A1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CYP51A1
genes like me logo Genes that share disorders with CYP51A1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CYP51A1 Gene

Publications for CYP51A1 Gene

  1. Structure and mapping of the human lanosterol 14alpha-demethylase gene (CYP51) encoding the cytochrome P450 involved in cholesterol biosynthesis; comparison of exon/intron organization with other mammalian and fungal CYP genes. (PMID: 8975714) Rozman D. … Waterman M.R. (Genomics 1996) 2 3 4 22 64
  2. Structural basis of human CYP51 inhibition by antifungal azoles. (PMID: 20149798) Strushkevich N. … Park H.W. (J. Mol. Biol. 2010) 3 4 22 64
  3. The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha- demethylase, a cytochrome P450 whose expression is regulated by oxysterols. (PMID: 8619637) Stroemstedt M. … Waterman M.R. (Arch. Biochem. Biophys. 1996) 3 4 22 64
  4. Sterol 14-demethylase P450 (P45014DM*) is one of the most ancient and conserved P450 species. (PMID: 8797093) Aoyama Y. … Yoshida Y. (J. Biochem. 1996) 3 4 22 64
  5. The three human cytochrome P450 lanosterol 14 alpha-demethylase (CYP51) genes reside on chromosomes 3, 7, and 13: structure of the two retrotransposed pseudogenes, association with a line-1 element, and evolution of the human CYP51 family. (PMID: 8809088) Rozman D. … Waterman M.R. (Arch. Biochem. Biophys. 1996) 3 4 22 64

Products for CYP51A1 Gene

Sources for CYP51A1 Gene

Content
Loading form....