Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

CTBP1 Gene

protein-coding   GIFtS: 69
GCID: GC04M001205

C-terminal binding protein 1

 Explore 19 diseases affiliated with
CTBP1 via our new
 Human Malady Compendium 
Biological research products
for CTBP1
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
C-Terminal Binding Protein 11 2     CtBP13
BARS1 2     EC 1.1.1.-3
Brefeldin A-Ribosylated Substrate2     EC 1.1.18
C-Terminal-Binding Protein 12     EC 1.1.1.1588
CTBP3     

External Ids:    HGNC: 24941   Entrez Gene: 14872   Ensembl: ENSG000001596927   OMIM: 6026185   UniProtKB: Q133633   

Export aliases for CTBP1 gene to outside databases

Previous GC identifers: GC04M001211 GC04M001195 GC04M001158 GC04M001173


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for CTBP1:
This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a
transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second
closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which
participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene
results in multiple transcript variants. (provided by RefSeq, Jul 2008)

UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
Function: Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex.
Functions in brown adipose tissue (BAT) differentiation. Corepressor targeting diverse transcription regulators such
as GLIS2. Has dehydrogenase activity

Gene Wiki entry for CTBP1


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000004.11  NC_018915.1  NT_037622.5  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the CTBP1 gene promoter:
         Egr-1   p300   MIF-1   Nkx2-5   Nkx5-1   Meis-1b   AREB6   Meis-1a   ATF6   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): CTBP1 promoter sequence
   Search SABiosciences Chromatin IP Primers for CTBP1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat CTBP1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 4p16   Ensembl cytogenetic band:  4p16.3   HGNC cytogenetic band: 4p16

CTBP1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
CTBP1 gene location

GeneLoc information about chromosome 4         GeneLoc Exon Structure

GeneLoc location for GC04M001205:  view genomic region     (about GC identifiers)

Start:
1,205,228 bp from pter      End:
1,243,741 bp from pter
Size:
38,514 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363 (See protein sequence)
Recommended Name: C-terminal-binding protein 1  
Size: 440 amino acids; 47535 Da
Cofactor: NAD. Required for efficient interaction with E1A. Cofactor binding induces a conformation change
Subunit: Homo- or heterodimer. Heterodimer with CTBP2. Interacts with PRDM16; the interaction represses white adipose
tissue (WAT)-specific genes expression. Interacts with GLIS2, FOXP2, HDAC4, HDAC5, HDAC9 and ZNF217 (By similarity).
Interacts with adenovirus E1A protein (via its C-terminus); the interaction disrupts the interaction of CTBP1 with
RBBP8. Interacts with Epstein-Barr virus EBNA3 and EBNA6. Interacts with ELK3 (via its PXDLS motif). Interacts with
RBBP8 (via its PXDLS motif); the interaction is disrupted by binding to adenovirus E1A. Interacts with FOXP1, HIPK2,
PNN, NRIP1, MECOM, ZNF366, ZFHX1B and WIZ. Interaction with SATB1 (non-acetylated form); the interaction stabilizes
its attachment to DNA and promotes transcription repression
Subcellular location: Cytoplasm. Nucleus
1 PDB 3D structure from and Proteopedia for CTBP1:
1MX3 (3D)    
Secondary accessions: Q4W5N3 Q7Z2Q5
Alternative splicing: 2 isoforms:  Q13363-1   Q13363-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for CTBP1: NX_Q13363

Post-translational modifications:

  • The level of phosphorylation appears to be regulated during the cell cycle. Phosphorylation by HIPK2 on Ser-422 induces
  • proteasomal degradation1
  • ADP-ribosylated; when cells are exposed to brefeldin A (By similarity)1
  • Sumoylation on Lys-428 is promoted by the E3 SUMO-protein ligase CBX41
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q13363

  • 4/5 DME Specific Peptides for CTBP1 (Q13363) (see all 5)
     ITLTREDL  VAHPPHAPSPGQT  PAAVEGIVPSAMSLSH  KQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVH 

    CTBP1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (2 alternative transcripts): 
    NP_001012632.1  NP_001319.1  

    ENSEMBL proteins: 
     ENSP00000372411   ENSP00000290921   ENSP00000422148   ENSP00000422364   ENSP00000424575  
     ENSP00000424684   ENSP00000422730   ENSP00000426470   ENSP00000425053   ENSP00000420983  
     ENSP00000423872  

    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Proteins (see all 2): CTBP1
    OriGene Protein Over-expression Lysate (see all 2): CTBP1
    OriGene Custom Protein Services for CTBP1 
    GenScript Custom Purified and Recombinant Proteins Services for CTBP1
    Novus Biologicals CTBP1 Proteins
    Novus Biologicals CTBP1 Lysates
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for CTBP1
    Uscn Proteins for CTBP1

    Gene Ontology (GO): 5/6 cellular component terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus ISS--
    GO:0005667transcription factor complex IEA--
    GO:0005730NOT nucleolus IDA--
    GO:0005737cytoplasm ----
    GO:0005829cytosol IEA--


    CTBP1 for ontologies           About GeneDecksing



    CTBP1 Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of CTBP1
    R&D Systems Antibodies for CTBP1
    Cell Signaling Technology (CST) Antibodies for CTBP1 
    OriGene Antibodies: CTBP1
    OriGene Custom Antibody Services for CTBP1 
    GenScript Custom Superior Antibodies Services for CTBP1
    Novus Biologicals CTBP1 Antibodies
    Abcam antibodies for CTBP1 
    Uscn Antibodies for CTBP1
    ThermoFisher Antibodies for CTBP1

    Assay Products for CTBP1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for CTBP1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for CTBP1


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    CTBP1 for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR006140 D-isomer_2_OHA_DH_NAD-bd
     IPR006139 D-isomer_2_OHA_DH_cat_dom
     IPR016040 NAD(P)-bd_dom

    Graphical View of Domain Structure for InterPro Entry Q13363

    ProtoNet protein and cluster: Q13363

    1 Blocks protein family: IPB006139 D-isomer specific 2-hydroxyacid dehydrogenase

    UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
    Similarity: Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
    Function: Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex.
    Functions in brown adipose tissue (BAT) differentiation. Corepressor targeting diverse transcription regulators such
    as GLIS2. Has dehydrogenase activity

         Genatlas biochemistry entry for CTBP1:
    C terminal binding protein 1,48kDa

    Enzyme Numbers (IUBMB): EC 1.1.1.1582 EC 1.1.12 EC 1.1.1.-1

    miRNA
    Products:
        
    miRTarBase miRNAs that target CTBP1:
    hsa-mir-137 (MIRT005605)

    OriGene 3'-UTR Clone (see all 2): CTBP1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat CTBP1
    8/39 QIAGEN miScript miRNA Assays for microRNAs that regulate CTBP1 (see all 39):
    hsa-miR-579 hsa-miR-485-3p hsa-miR-409-5p hsa-miR-761 hsa-miR-1290 hsa-miR-4324 hsa-miR-548am hsa-miR-4289
    SwitchGear 3'UTR luciferase reporter plasmidCTBP1 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for CTBP1 (see all 7)
    OriGene shRNA RFP: CTBP1
    OriGene siRNA: CTBP1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat CTBP1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for CTBP1

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): CTBP1 (NM_001328)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for CTBP1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for CTBP1
    Search LifeMap BioReagents cell lines for CTBP1

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1

    Gene Ontology (GO): 5/11 molecular function terms (GO ID links to tree view) (see all 11):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000166nucleotide binding ----
    GO:0001106RNA polymerase II transcription corepressor activity IDA19162039
    GO:0003700sequence-specific DNA binding transcription factor activity IEA--
    GO:0005515protein binding IPI16287852
    GO:0008022protein C-terminus binding TAS8440238


    CTBP1 for ontologies           About GeneDecksing


    1 GenomeRNAi human phenotype for CTBP1:
     Increased viability after born 

    Animal Models:
         Mouse knock-out Ctbp1tm1Sor for CTBP1
         7 MGI mutant phenotypes (inferred from 1 allele(MGI details for Ctbp1):
     cardiovascular system  embryogenesis  growth/size  mortality/aging  muscle 
     nervous system  skeleton 

    CTBP1 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/15 super-pathways (see all 15About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Wnt Signaling Pathway
    Wnt Signaling Pathway and Pluripotency0.55
    Wnt Signaling Pathway NetPath0.22
    Wnt signaling pathway0.30
    2Development_Ligand-dependent activation of the ESR1/AP-1 pathway
    Development_Ligand-dependent activation of the ESR1/AP-1 pathway1.00
    Development Ligand-dependent activation of the ESR1/AP-1 pathway1.00
    3Notch Signaling Pathway
    Notch Signaling Pathway1.00
    Notch signaling pathway0.82
    4Glucose / Energy Metabolism
    Glucose / Energy Metabolism1.00
    5SMAD Signaling Network
    SMAD Signaling Network1.00

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for CTBP1
        Development Ligand-dependent activation of the ESR1/AP-1 pathway

    2 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for CTBP1
        SMAD Signaling Network
    GSK3 Signaling

    2 Cell Signaling Technology (CST) Pathways for CTBP1
        Chromatin Regulation / Acetylation
    Glucose / Energy Metabolism

    1 GeneGo (Thomson Reuters) Pathway for CTBP1
        Development Ligand-dependent activation of the ESR1/AP-1 pathway

    5/9 BioSystems Pathways for CTBP1 (see all 9
        Wnt Signaling Pathway and Pluripotency
    Notch Signaling Pathway
    Wnt Signaling Pathway NetPath
    Notch-mediated HES/HEY network
    Regulation of nuclear SMAD2/3 signaling


    4         Kegg Pathways  (Kegg details for CTBP1):
        Wnt signaling pathway
    Notch signaling pathway
    Pathways in cancer
    Chronic myeloid leukemia


    CTBP1 for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for CTBP1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/147 Interacting proteins for CTBP1 (Q133631, 2, 3 ENSP000002909214) via UniProtKB, MINT, STRING, and/or I2D (see all 147)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    TGIF1Q155832, 3, ENSP000003279594MINT-14492 MINT-14493 I2D: score=4 STRING: ENSP00000327959
    ZEB1P372752, 3, ENSP000003192484MINT-17555 I2D: score=6 STRING: ENSP00000319248
    CHD3Q128732, 3, ENSP000003697164MINT-8253847 I2D: score=2 STRING: ENSP00000369716
    CTNNA1P352212, 3, ENSP000003046694MINT-8253858 I2D: score=2 STRING: ENSP00000304669
    HIC1Q145261, 3, ENSP000003140804EBI-908846,EBI-2507362 I2D: score=2 STRING: ENSP00000314080
    About this table

    Gene Ontology (GO): 5/14 biological process terms (GO ID links to tree view) (see all 14):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000122negative regulation of transcription from RNA polymerase II promoter IMP19162039
    GO:0006468protein phosphorylation TAS8440238
    GO:0007030Golgi organization IEA--
    GO:0008285negative regulation of cell proliferation TAS7479821
    GO:0019048virus-host interaction IEA--


    CTBP1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    CTBP1 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for CTBP1

    1 HMDB Compound for CTBP1    About this table
    CompoundSynonyms CAS #PubMed Ids
    NAD3-Carbamoyl-1-D-ribofuranosylpyridinium hydroxide 5'-ester with adenosine 5'-pyrophosphate (see all 28)53-84-9--

    2 DrugBank Compounds for CTBP1    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    Formic AcidAminic acid (see all 5)64-18-6target--17139284 17016423 10592235
    Nicotinamide-Adenine-Dinucleotide-- 53-84-9target--10592235

    7 Novoseek chemical compound relationships for CTBP1 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    nadh 60.5 35 11847309 (3), 12872005 (3), 17508915 (2), 18184656 (2) (see all 17)
    nad+ 52.1 15 12872005 (4), 12606049 (3), 11847309 (2), 12419229 (2) (see all 8)
    zinc 47.3 6 20175752 (1), 12556451 (1), 10567582 (1), 16940172 (1) (see all 5)
    lysine 30.7 8 16919702 (3), 12679040 (1), 12161448 (1), 16122695 (1)
    pyruvate 3.46 2 8416925 (1), 17157814 (1)
    oxygen 0 1 18676825 (1)
    retinoic acid 0 2 17028196 (2)

    Search CenterWatch for drugs/clinical trials and news about CTBP1 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for CTBP1 gene (2 alternative transcripts): 
    NM_001012614.1  NM_001328.2  

    Unigene Cluster for CTBP1:

    C-terminal binding protein 1
    Hs.208597  [show with all ESTs]
    Unigene Representative Sequence: BC064333
    18 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000382952(uc003gcu.1) ENST00000290921(uc003gcv.1 uc003gcw.3)
    ENST00000503594 ENST00000514596 ENST00000504092 ENST00000382950 ENST00000510739
    ENST00000511907 ENST00000505826 ENST00000514669 ENST00000506180 ENST00000504784
    ENST00000514210 ENST00000514495 ENST00000515399 ENST00000513420 ENST00000510568(uc003gcx.1)
    ENST00000515690

    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 2): CTBP1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat CTBP1
    8/39 QIAGEN miScript miRNA Assays for microRNAs that regulate CTBP1 (see all 39):
    hsa-miR-579 hsa-miR-485-3p hsa-miR-409-5p hsa-miR-761 hsa-miR-1290 hsa-miR-4324 hsa-miR-548am hsa-miR-4289
    SwitchGear 3'UTR luciferase reporter plasmidCTBP1 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for CTBP1 (see all 7)
    OriGene shRNA RFP: CTBP1
    OriGene siRNA: CTBP1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat CTBP1
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1 (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): CTBP1 (NM_001328)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for CTBP1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for CTBP1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat CTBP1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat CTBP1

    Additional cDNA sequence: 

    AF091555.1 BC011655.2 BC053320.1 BC064333.1 BC072021.1 BC098400.1 U37408.1 

    24/29 DOTS entries (see all 29):

    DT.95120753  DT.91766289  DT.119174  DT.100662472  DT.121643846  DT.100702132  DT.100830096  DT.100821782 
    DT.100821778  DT.100821786  DT.100642999  DT.100037745  DT.100728975  DT.100857972  DT.121228061  DT.100808505 
    DT.100821779  DT.100821781  DT.100821783  DT.121228064  DT.95349696  DT.97762053  DT.100663982  DT.100692411 

    24/397 AceView cDNA sequences (see all 397):

    AU117448 BQ018373 AI351337 BM851622 AI766365 BM712795 BU180468 AI301641 
    CD671503 AA377050 BI836308 BQ897865 AI362845 BF434044 N22109 BX108706 
    BM763348 CA413495 AI308150 BF221764 BX394032 BM918472 BQ420441 AI168198 

    GeneLoc Exon Structure

    5/16 Alternative Splicing Database (ASD) splice patterns (SP) for CTBP1 (see all 16)    About this scheme

    ExUns: 1a · 1b ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12a · 12b · 12c · 12d · 12e ^ 13 ^ 14a · 14b ^ 15a ·
    SP1:                                      -     -                             -     -     -                                               -                     
    SP2:                                      -     -     -     -     -           -     -     -                                               -                     
    SP3:                                                                                                                                      -                     
    SP4:                                      -     -                             -     -     -                                                                     
    SP5:                                                                          -     -     -                                               -                     

    ExUns: 15b ^ 16 ^ 17 ^ 18a · 18b · 18c
    SP1:  -                                 
    SP2:  -                                 
    SP3:  -                                 
    SP4:                                    
    SP5:                                    


    ECgene alternative splicing isoforms for CTBP1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    CTBP1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TTTGTGACTG

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See CTBP1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for CTBP1

    SOURCE GeneReport for Unigene cluster: Hs.208597
        SABiosciences Expression via Pathway-Focused PCR Arrays including CTBP1: 
              WNT Signaling Pathway in human mouse rat
              Polycomb & Trithorax Complexes in human mouse rat
              Tumor Metastasis in human mouse rat
              Epigenetic Chromatin Remodeling Factors in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for CTBP1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat CTBP1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat CTBP1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the last universal common ancestor (LUCA).

    Orthologs for CTBP1 gene from 9/26 species (see all 26)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves CTBP11 C-terminal binding protein 1 79.16(n)
    96.49(a)
      422904  NM_001012890.1  NP_001012908.1 
    lizard
    (Anolis carolinensis)
    Reptilia CTBP16
    --
    94(a)
    1 ↔ 1
    GL343447.1(523031-546086)
    African clawed frog
    (Xenopus laevis)
    Amphibia ctbp1-A2 C-terminal binding protein 1 78.46(n)    AF091554.1 
    zebrafish
    (Danio rerio)
    Actinopterygii ctbp12 C-terminal binding protein 1 76.5(n)   65229  AB032415.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta CtBP3 negative regulation of transcription from
    Pol more
    72(a)   87D9   --
    worm
    (Caenorhabditis elegans)
    Secernentea F49E10.53
    ctbp-11
    dehydrogenase3
    Protein CTBP-11
    53(a)3
    53.09(n)1
    53.37(a)1
      X(5898026-5908015)3
    1808531  NM_076582.31  NP_508983.21 
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons AT1G721906
    D-isomer specific 2-hydroxyacid dehydrogenase-like...
    18(a)
    1 → many
    1(27167363-27169717)
    rice
    (Oryza sativa)
    Liliopsida --
    --
    erythronate-4-phosphate dehydrogenase domain conta...
    erythronate-4-phosphate dehydrogenase domain conta...
    16(a)
    16(a)
    many ↔ many
    many ↔ many
    7(9296739-9299506)
    7(9352047-9356795)
    E. coli
    (Escherichia coli)
    Gamma proteobacteria ghrA6
    glyoxylate/hydroxypyruvate reductase A
    19(a)
    possible ortholog
    Chromosome(1097109-1098047)


    ENSEMBL Gene Tree for CTBP1 (if available)
    TreeFam Gene Tree for CTBP1 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for CTBP1 gene
    PHGDH2  CTBP22  ENSG000002128842  
    2 SIMAP similar genes for CTBP1 using alignment to 12 protein entries:     CTBP1_HUMAN (see all proteins):
    DKFZp434B0914    CTBP2

    CTBP1 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 3 variations for CTBP1
         3 CNVs: 68601 53617 68602
    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing CTBP1
    DNA2.0 Custom Variant and Variant Library Synthesis for CTBP1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    CTBP1 for disorders           About GeneDecksing

    OMIM gene information: 602618    OMIM disorders: --

    19 diseases for CTBP1:    About MalaCards
    familial adenomatous polyposis    adenomatous polyposis coli    polyposis    chronic myeloid leukemia
    myeloid leukemia    holoprosencephaly    lymphopenia    colon carcinoma
    colorectal cancer    nephropathy    hepatitis b    breast cancer
    leukemia    melanoma    carcinoma    adenoma
    hepatitis    hypoxia    neuronitis

    10 Novoseek disease relationships for CTBP1 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    familial adenomatous polyposis 36 3 17028196 (2)
    colon cancer 31.6 1 19798104 (1)
    colorectal cancer 13.7 7 16547505 (3), 17028196 (1), 16510874 (1), 20383323 (1)
    tumors 12.9 15 16740659 (3), 16804902 (3), 18086895 (2), 15831459 (1) (see all 9)
    cancer 10.5 8 17662696 (2), 16547590 (1), 20372804 (1), 16740659 (1) (see all 7)
    colon carcinoma 2.09 3 16804902 (2), 15831101 (1)
    breast cancer 1.78 3 19744932 (1)
    carcinoma 0 2 19450512 (2)
    lymphoma 0 1 18212045 (1)
    melanoma 0 23 19216735 (7), 12384563 (3), 14702186 (1)

    Human Genome Epidemiology (HuGE) Navigator: CTBP1 (4 documents)

    Export disorders for CTBP1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for CTBP1 gene, integrated from 9 sources (see all 225):
    (articles sorted by number of sources associating them with CTBP1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. C-terminal binding protein is a transcriptional repressor that interacts with a specific class of vertebrate polycomb proteins. (PubMed id 9858600)1, 2, 9 Sewalt R.G.A.B....Otte A.P. (1999)
    2. Acetylation-dependent interaction of SATB1 and CtBP1 mediates transcriptional repression by SATB1. (PubMed id 19103759)1, 2, 9 Purbey P.K.... Galande S. (2009)
    3. Acetylation of nuclear hormone receptor-interacting protein RIP140 regulates binding of the transcriptional corepressor CtBP. (PubMed id 11509661)1, 2, 9 Vo N.... Goodman R.H. (2001)
    4. The polycomb protein Pc2 is a SUMO E3. (PubMed id 12679040)1, 2, 9 Kagey M.H.... Wotton D. (2003)
    5. Transcription corepressor CtBP is an NAD(+)-regulated dehydrogenase. (PubMed id 12419229)1, 2, 9 Kumar V.... Aggarwal A.K. (2002)
    6. Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene. (PubMed id 15542832)1, 2, 9 Alpatov R.... Sugrue S.P. (2004)
    7. A novel C-terminal binding protein (CTBP2) is closely related to CTBP1, an adenovirus E1A-binding protein, and maps to human chromosome 21q21.3. (PubMed id 9479502)1, 3, 9 Katsanis N. and Fisher E.M.C. (1998)
    8. A region in the C-terminus of adenovirus 2/5 E1a protein is required for association with a cellular phosphoprotein and important for the negative modulation of T24-ras mediated transformation, tumorigenesis and metastasis. (PubMed id 8440238)1, 2, 9 Boyd J.M....Chinnadurai G. (1993)
    9. Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin. (PubMed id 16061479)1, 2, 9 Long J.... Park M. (2005)
    10. Interaction of EVI1 with cAMP-responsive element-binding protein- binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles. (PubMed id 11568182)1, 2, 9 Chakraborty S.... Nucifora G. (2001)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 1487 HGNC: 2494 AceView: CTBP1 Ensembl:ENSG00000159692 euGenes: HUgn1487
    ECgene: CTBP1 Kegg: 1487 H-InvDB: CTBP1

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for CTBP1 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for CTBP1 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for CTBP1 gene:
    Search GeneIP for patents involving CTBP1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of CTBP1
     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Small Molecules at EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     Browse Purified and Recombinant Proteins at EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for CTBP1 (CtBP1)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for CTBP1   OriGene shRNA RFP for CTBP1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for CTBP1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for CTBP1  
     OriGene Protein Over-expression Lysate for CTBP1   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for CTBP1   OriGene 3'-UTR Clone for CTBP1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for CTBP1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for CTBP1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for CTBP1   OriGene Custom Protein Services for CTBP1  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat CTBP1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing CTBP1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat CTBP1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat CTBP1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat CTBP1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
     GenScript Custom Purified and Recombinant Proteins Services for CTBP1 GenScript cDNA clones with any tag delivered in your preferred vector for CTBP1
     GenScript Custom Assay Services for CTBP1 GenScript Custom Superior Antibodies Services for CTBP1
     GenScript Custom overexpressing Cell Line Services for CTBP1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Antibodies & Assays for CTBP1 

     Regulatory tfbs in CTBP1 promoter
     Search Chromatin IP Primers for CTBP1
     RT2 qPCR Primer Assay in human, mouse, rat CTBP1
     GNC Network for CTBP1
     SABiosciences PCR Arrays including human, mouse, rat CTBP1
     Search Tocris compounds for CTBP1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     CTBP1 antibodies
     CTBP1 proteins
     CTBP1 lysates
     Antibodies for CTBP1
     See all of Abcam's Antibodies, Kits and Proteins for CTBP1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for CTBP1




     CTBP1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for CTBP1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1
     SwitchGear 3'UTR luciferase reporter plasmids for CTBP1
     SwitchGear Promoter luciferase reporter plasmids for CTBP1
     ThermoFisher Antibodies for CTBP1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      CTBP1 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4