Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



CTBP1 Gene

protein-coding   GIFtS: 71
GCID: GC04M001205

C-Terminal Binding Protein 1

Microbiology & Infectious Diseases Congress
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
C-Terminal Binding Protein 11 2     CtBP13
Brefeldin A-Ribosylated Substrate1 2     EC 1.1.1.-3
BARS2     EC 1.1.18
C-Terminal-Binding Protein 12     EC 1.1.1.1588
CTBP3     

External Ids:    HGNC: 24941   Entrez Gene: 14872   Ensembl: ENSG000001596927   OMIM: 6026185   UniProtKB: Q133633   

Export aliases for CTBP1 gene to outside databases

Previous GC identifers: GC04M001211 GC04M001195 GC04M001158 GC04M001173


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

Entrez Gene summary for CTBP1 Gene:
This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a
transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a
second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein
complex which participates in regulation of gene expression during development. Alternative splicing of
transcripts from this gene results in multiple transcript variants. (provided by RefSeq, Jul 2008)

GeneCards Summary for CTBP1 Gene:
CTBP1 (C-terminal binding protein 1) is a protein-coding gene. Diseases associated with CTBP1 include familial adenomatous polyposis, and holoprosencephaly. GO annotations related to this gene include transcription factor binding and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is PHGDH.

UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
Function: Corepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase
activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex.
Functions in brown adipose tissue (BAT) differentiation

Gene Wiki entry for CTBP1 Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence:
NC_000004.12  NT_006051.19  NC_018915.2  
Regulatory elements:
   Regulatory transcription factor binding sites in the CTBP1 gene promoter:
         Egr-1   p300   MIF-1   Nkx2-5   Nkx5-1   Meis-1b   AREB6   Meis-1a   ATF6   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): CTBP1 promoter sequence
   Search Chromatin IP Primers for CTBP1

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat CTBP1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 4p16   Ensembl cytogenetic band:  4p16.3   HGNC cytogenetic band: 4p16

CTBP1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
CTBP1 gene location

GeneLoc information about chromosome 4         GeneLoc Exon Structure

GeneLoc location for GC04M001205:  view genomic region     (about GC identifiers)

Start:
1,205,228 bp from pter      End:
1,243,741 bp from pter
Size:
38,514 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363 (See protein sequence)
Recommended Name: C-terminal-binding protein 1  
Size: 440 amino acids; 47535 Da
Cofactor: NAD. Required for efficient interaction with E1A. Cofactor binding induces a conformation change
Subunit: Homo- or heterodimer. Heterodimer with CTBP2. Interacts with PRDM16; the interaction represses white
adipose tissue (WAT)-specific genes expression. Interacts with GLIS2, FOXP2, HDAC4, HDAC5, HDAC9 and ZNF217.
Interacts with adenovirus E1A protein (via its C-terminus); the interaction disrupts the interaction of CTBP1
with RBBP8. Interacts with Epstein-Barr virus EBNA3 and EBNA6. Interacts with ELK3 (via its PXDLS motif).
Interacts with RBBP8 (via its PXDLS motif); the interaction is disrupted by binding to adenovirus E1A. Interacts
with FOXP1, HIPK2, PNN, NRIP1, MECOM, ZNF366, ZFHX1B and WIZ. Interaction with SATB1 (non-acetylated form); the
interaction stabilizes its attachment to DNA and promotes transcription repression. Interacts with BCL6; the
interaction is required for BCL6 transcriptional autoinhibition and inhibition of some BCL6 target genes
1 PDB 3D structure from and Proteopedia for CTBP1:
1MX3 (3D)    
Secondary accessions: Q4W5N3 Q7Z2Q5
Alternative splicing: 2 isoforms:  Q13363-1   Q13363-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for CTBP1: NX_Q13363

Explore proteomics data for CTBP1 at MOPED

Post-translational modifications: 

  • The level of phosphorylation appears to be regulated during the cell cycle. Phosphorylation by HIPK2 on Ser-422
    induces proteasomal degradation1
  • ADP-ribosylated; when cells are exposed to brefeldin A (By similarity)1
  • Sumoylation on Lys-428 is promoted by the E3 SUMO-protein ligase CBX41
  • Ubiquitination2 at Lys194, Lys273
  • Modification sites at PhosphoSitePlus
  • Selected DME Specific Peptides for CTBP1 (Q13363) (see all 5)
     ITLTREDL  VAHPPHAPSPGQT  PAAVEGIVPSAMSLSH  KQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVH 


    See CTBP1 Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins (2 alternative transcripts): 
    NP_001012632.1  NP_001319.1  

    ENSEMBL proteins: 
     ENSP00000372411   ENSP00000290921   ENSP00000422148   ENSP00000422364   ENSP00000424575  
     ENSP00000424684   ENSP00000422730   ENSP00000426470   ENSP00000425053   ENSP00000420983  
     ENSP00000423872  
    Reactome Protein details: Q13363

    CTBP1 Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Proteins for CTBP1
    OriGene Protein Over-expression Lysate for CTBP1
    OriGene MassSpec for CTBP1
    OriGene Custom Protein Services for CTBP1
    GenScript Custom Purified and Recombinant Proteins Services for CTBP1
    Novus Biologicals CTBP1 Proteins
    Novus Biologicals CTBP1 Lysates
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    ProSpec Recombinant Protein for CTBP1
    Cloud-Clone Corp. Proteins for CTBP1

    CTBP1 Antibody Products:

    EMD Millipore Mono- and Polyclonal Antibodies for the study of CTBP1
    R&D Systems Antibodies for CTBP1
    Cell Signaling Technology (CST) Antibodies for CTBP1 
    OriGene Antibodies for CTBP1
    OriGene Custom Antibody Services for CTBP1
    Novus Biologicals CTBP1 Antibodies
    Abcam antibodies for CTBP1
    Cloud-Clone Corp. Antibodies for CTBP1
    ThermoFisher Antibody for CTBP1
    LSBio Antibodies in human, mouse, rat for CTBP1

    CTBP1 Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for CTBP1
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for CTBP1
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for CTBP1
    Cloud-Clone Corp. CLIAs for CTBP1


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    3 InterPro protein domains:
     IPR006140 D-isomer_2_OHA_DH_NAD-bd
     IPR006139 D-isomer_2_OHA_DH_cat_dom
     IPR016040 NAD(P)-bd_dom

    Graphical View of Domain Structure for InterPro Entry Q13363

    ProtoNet protein and cluster: Q13363

    1 Blocks protein domain: IPB006139 D-isomer specific 2-hydroxyacid dehydrogenase

    UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
    Similarity: Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family


    CTBP1 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: CTBP1_HUMAN, Q13363
    Function: Corepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase
    activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex.
    Functions in brown adipose tissue (BAT) differentiation

         Genatlas biochemistry entry for CTBP1:
    C terminal binding protein 1,48kDa

         Enzyme Numbers (IUBMB): EC 1.1.1.1582 EC 1.1.12 EC 1.1.1.-1

         Gene Ontology (GO): Selected molecular function terms (see all 12):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0001106RNA polymerase II transcription corepressor activity IDA16287852
    GO:0003700sequence-specific DNA binding transcription factor activity IEA--
    GO:0004616phosphogluconate dehydrogenase (decarboxylating) activity ----
    GO:0005515protein binding IPI11568182
    GO:0008022protein C-terminus binding TAS8440238
         
    CTBP1 for ontologies           About GeneDecksing


    Phenotypes:
         1 GenomeRNAi human phenotype for CTBP1:
     Increased viability after born 

         7 MGI mutant phenotypes (inferred from 1 allele(MGI details for Ctbp1):
     cardiovascular system  embryogenesis  growth/size/body  mortality/aging  muscle 
     nervous system  skeleton 

    CTBP1 for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Ctbp1tm1Sor for CTBP1

       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for CTBP1
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for CTBP1

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for CTBP1
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for CTBP1

    miRNA
    Products:
        
    miRTarBase miRNAs that target CTBP1:
    hsa-mir-26a-5p (MIRT050145), hsa-mir-1 (MIRT024026), hsa-mir-10b-5p (MIRT047493), hsa-mir-137 (MIRT005605), hsa-mir-940 (MIRT036611)

    Block miRNA regulation of human, mouse, rat CTBP1 using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate CTBP1 (see all 39):
    hsa-miR-579 hsa-miR-485-3p hsa-miR-409-5p hsa-miR-761 hsa-miR-1290 hsa-miR-4324 hsa-miR-548am hsa-miR-4289
    SwitchGear 3'UTR luciferase reporter plasmidCTBP1 3' UTR sequence
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for CTBP1
    Predesigned siRNA for gene silencing in human, mouse, rat CTBP1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for CTBP1

    Clone
    Products:
         
    OriGene clones in human, mouse for CTBP1 (see all 11)
    OriGene ORF clones in mouse, rat for CTBP1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): CTBP1 (NM_001328)
    Sino Biological Human cDNA Clone for CTBP1
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for CTBP1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for CTBP1
    Browse ESI BIO Cell Lines and PureStem Progenitors for CTBP1 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from UniProtKB/Swiss-Prot
    CTBP1_HUMAN, Q13363: Cytoplasm. Nucleus
    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    nucleus5
    cytoskeleton3
    cytosol2
    golgi apparatus2
    mitochondrion2
    extracellular1
    peroxisome1

    Gene Ontology (GO): 5 cellular component terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus ISS--
    GO:0005667transcription factor complex IEA--
    GO:0005730NOT nucleolus IDA--
    GO:0005829cytosol IEA--
    GO:0017053transcriptional repressor complex ISS--

    CTBP1 for ontologies           About GeneDecksing


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus

    SuperPaths for CTBP1 About   (see all 17)  
    See pathways by source

    SuperPathContained pathways About
    1Notch signaling pathway (KEGG)
    Notch signaling pathway0.84
    Notch Signaling Pathway0.84
    2Wnt signaling pathway (KEGG)
    Wnt signaling pathway0.40
    Wnt Signaling Pathway NetPath0.37
    3Nanog in Mammalian ESC Pluripotency
    GSK3 Signaling0.61
    4Wnt Signaling Pathway (WikiPathways)
    Wnt Signaling Pathway and Pluripotency0.55
    5Chronic myeloid leukemia
    Chronic myeloid leukemia0.42

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways

    1 R&D Systems Pathway for CTBP1
        Notch Signaling Pathways

    2 Downloadable PowerPoint Slides of GeneGlobe Pathway Central Maps for CTBP1
        SMAD Signaling Network
    GSK3 Signaling

    2 Cell Signaling Technology (CST) Pathways for CTBP1
        Chromatin Regulation / Acetylation
    Glucose / Energy Metabolism

    1 GeneGo (Thomson Reuters) Pathway for CTBP1
        Development Ligand-dependent activation of the ESR1/AP-1 pathway

    Selected BioSystems Pathways for CTBP1 (see all 9)
        Wnt Signaling Pathway and Pluripotency
    Notch Signaling Pathway
    Wnt Signaling Pathway NetPath
    Regulation of nuclear SMAD2/3 signaling
    Regulation of retinoblastoma protein


    1 Reactome Pathway for CTBP1
        deactivation of the beta-catenin transactivating complex


    4 Kegg Pathways  (Kegg details for CTBP1):
        Wnt signaling pathway
    Notch signaling pathway
    Pathways in cancer
    Chronic myeloid leukemia


    CTBP1 for pathways           About GeneDecksing

        Pathway & Disease-focused RT2 Profiler PCR Arrays including CTBP1: 
              WNT Signaling Pathway in human mouse rat
              Polycomb & Trithorax Complexes in human mouse rat
              Tumor Metastasis in human mouse rat
              Epigenetic Chromatin Remodeling Factors in human mouse rat

    Interactions:

        GeneGlobe Interaction Network for CTBP1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    Selected Interacting proteins for CTBP1 (Q133631, 2, 3 ENSP000002909214) via UniProtKB, MINT, STRING, and/or I2D (see all 184)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    TGIF1Q155832, 3, ENSP000003279594MINT-14492 MINT-14493 I2D: score=4 STRING: ENSP00000327959
    ZEB1P372752, 3, ENSP000003192484MINT-17555 I2D: score=6 STRING: ENSP00000319248
    CHD3Q128732, 3, ENSP000003697164MINT-8253847 I2D: score=2 STRING: ENSP00000369716
    CTNNA1P352212, 3, ENSP000003046694MINT-8253858 I2D: score=2 STRING: ENSP00000304669
    HIC1Q145261, 3, ENSP000003140804EBI-908846,EBI-2507362 I2D: score=2 STRING: ENSP00000314080
    About this table

    Gene Ontology (GO): Selected biological process terms (see all 16):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000122negative regulation of transcription from RNA polymerase II promoter IMP19162039
    GO:0006098pentose-phosphate shunt ----
    GO:0006468protein phosphorylation TAS8440238
    GO:0007030Golgi organization IEA--
    GO:0008152metabolic process ----

    CTBP1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for CTBP1

    1 HMDB Compound for CTBP1    About this table
    CompoundSynonyms CAS #PubMed Ids
    NAD3-Carbamoyl-1-D-ribofuranosylpyridinium hydroxide 5'-ester with adenosine 5'-pyrophosphate (see all 28)53-84-9--

    2 DrugBank Compounds for CTBP1    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    Formic AcidAminic acid (see all 5)64-18-6target--17139284 17016423 10592235
    Nicotinamide-Adenine-Dinucleotide-- 53-84-9target--10592235

    7 Novoseek inferred chemical compound relationships for CTBP1 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    nadh 60.5 35 11847309 (3), 12872005 (3), 17508915 (2), 18184656 (2) (see all 17)
    nad+ 52.1 15 12872005 (4), 12606049 (3), 11847309 (2), 12419229 (2) (see all 8)
    zinc 47.3 6 20175752 (1), 12556451 (1), 10567582 (1), 16940172 (1) (see all 5)
    lysine 30.7 8 16919702 (3), 12679040 (1), 12161448 (1), 16122695 (1)
    pyruvate 3.46 2 8416925 (1), 17157814 (1)
    oxygen 0 1 18676825 (1)
    retinoic acid 0 2 17028196 (2)



    CTBP1 for compounds           About GeneDecksing



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, and/or QIAGEN )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for CTBP1 gene (2 alternative transcripts): 
    NM_001012614.1  NM_001328.2  

    Unigene Cluster for CTBP1:

    C-terminal binding protein 1
    Hs.208597  [show with all ESTs]
    Unigene Representative Sequence: BC064333
    18 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000382952(uc003gcu.1) ENST00000290921(uc003gcv.1 uc003gcw.3)
    ENST00000503594 ENST00000514596 ENST00000504092 ENST00000382950 ENST00000510739
    ENST00000511907 ENST00000505826 ENST00000514669 ENST00000506180 ENST00000504784
    ENST00000514210 ENST00000514495 ENST00000515399 ENST00000513420 ENST00000510568(uc003gcx.1)
    ENST00000515690
    Congresses - knowledge worth sharing:
    European Congress of Clinical Microbiology and Infectious Diseases (ECCMID) 10 - 13 May 2014

    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat CTBP1 using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate CTBP1 (see all 39):
    hsa-miR-579 hsa-miR-485-3p hsa-miR-409-5p hsa-miR-761 hsa-miR-1290 hsa-miR-4324 hsa-miR-548am hsa-miR-4289
    SwitchGear 3'UTR luciferase reporter plasmidCTBP1 3' UTR sequence
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for CTBP1
    Predesigned siRNA for gene silencing in human, mouse, rat CTBP1
    Clone
    Products:
         
    OriGene clones in human, mouse for CTBP1 (see all 11)
    OriGene ORF clones in mouse, rat for CTBP1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): CTBP1 (NM_001328)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for CTBP1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for CTBP1
    OriGene qSTAR qPCR primer pairs in human, mouse for CTBP1
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat CTBP1
      QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
      QuantiFast Probe-based Assays in human, mouse, rat CTBP1

    Additional mRNA sequence: 

    AF091555.1 BC011655.2 BC053320.1 BC064333.1 BC072021.1 BC098400.1 U37408.1 

    Selected DOTS entries (see all 29):

    DT.95120753  DT.91766289  DT.119174  DT.100662472  DT.121643846  DT.100830096  DT.100702132  DT.100821782 
    DT.100821778  DT.100642999  DT.100821786  DT.100037745  DT.100857972  DT.121228061  DT.100728975  DT.100808505 
    DT.100821779  DT.100821781  DT.100821783  DT.121228064  DT.95349696  DT.97762053  DT.100663982  DT.121228081 

    Selected AceView cDNA sequences (see all 397):

    BU180468 BF116170 CF242800 AI216417 BM849180 BM763940 AI074182 AW274366 
    AI022104 AI351337 CB216664 BX108706 CR608612 BM923969 AI435033 BM763348 
    AI812050 AI392651 BC011655 CA413495 BF941873 AI380620 AW043755 BM994582 

    GeneLoc Exon Structure

    Selected Alternative Splicing Database (ASD) splice patterns (SP) for CTBP1 (see all 16)    About this scheme

    ExUns: 1a · 1b ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7 ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12a · 12b · 12c · 12d · 12e ^ 13 ^ 14a · 14b ^ 15a ·
    SP1:                                      -     -                             -     -     -                                               -                     
    SP2:                                      -     -     -     -     -           -     -     -                                               -                     
    SP3:                                                                                                                                      -                     
    SP4:                                      -     -                             -     -     -                                                                     
    SP5:                                                                          -     -     -                                               -                     

    ExUns: 15b ^ 16 ^ 17 ^ 18a · 18b · 18c
    SP1:  -                                 
    SP2:  -                                 
    SP3:  -                                 
    SP4:                                    
    SP5:                                    


    ECgene alternative splicing isoforms for CTBP1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    CTBP1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TTTGTGACTG
    CTBP1 Expression
    About this image


    CTBP1 expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database
     selected tissues (see all 17) fully expand
     
     Brain (Nervous System)    fully expand to see all 4 entries
             Cerebral Cortex
     
     Pancreas (Endocrine System)
             Islets of Langerhans
     
     Ovary (Reproductive System)
             Ovarian Mesenchymal Stroma Cells Ovary Interstitium
     
     Trophoblast (Extraembryonic Tissues)
             Trophoblast Cells Trophoblast
     
     Testis (Reproductive System)
             Leydig Cells Testis Interstitium
    CTBP1 Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    CTBP1 Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.208597

    UniProtKB/Swiss-Prot: CTBP1_HUMAN, Q13363
    Tissue specificity: Expressed in germinal center B-cells

        Pathway & Disease-focused RT2 Profiler PCR Arrays including CTBP1: 
              WNT Signaling Pathway in human mouse rat
              Polycomb & Trithorax Complexes in human mouse rat
              Tumor Metastasis in human mouse rat
              Epigenetic Chromatin Remodeling Factors in human mouse rat

    Primer
    Products:
    OriGene qPCR primer pairs and template standards for CTBP1
    OriGene qSTAR qPCR primer pairs in human, mouse for CTBP1
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat CTBP1
    QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
    QuantiFast Probe-based Assays in human, mouse, rat CTBP1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of animals and fungi.

    Orthologs for CTBP1 gene from Selected species (see all 16)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Ctbp11 , 5 C-terminal binding protein 11, 5 88.56(n)1
    98.86(a)1
      5 (17.52 cM)5
    130161  NM_013502.31  NP_038530.11 
     332477245 
    chicken
    (Gallus gallus)
    Aves CTBP11 C-terminal binding protein 1 79.16(n)
    96.49(a)
      422904  NM_001012890.1  NP_001012908.1 
    lizard
    (Anolis carolinensis)
    Reptilia CTBP16
    C-terminal binding protein 1
    96(a)
    1 ↔ 1
    GL343447.1(515825-547797)
    African clawed frog
    (Xenopus laevis)
    Amphibia ctbp1-A2 C-terminal binding protein 1 78.46(n)    AF091554.1 
    zebrafish
    (Danio rerio)
    Actinopterygii ctbp12 C-terminal binding protein 1 76.5(n)   65229  AB032415.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta CtBP3 negative regulation of transcription
    from Pol more
    72(a)   87D9   --
    worm
    (Caenorhabditis elegans)
    Secernentea F49E10.53
    ctbp-11
    dehydrogenase3
    ctbp-11
    53(a)3
    53.09(n)1
    53.37(a)1
      X(5898026-5908015)3
    1808531  NM_001270101.11  NP_001257030.11 
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes SER36
    SER336
    3-phosphoglycerate dehydrogenase, catalyzes the fi...
    3-phosphoglycerate dehydrogenase, catalyzes the fi...
    20(a)
    20(a)
    many ↔ many
    many ↔ many
    V(322686-324095) YER081W
    IX(221081-222490) YIL074C


    ENSEMBL Gene Tree for CTBP1 (if available)
    TreeFam Gene Tree for CTBP1 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for CTBP1 gene
    PHGDH2  CTBP22  ENSG000002128842  
    2 SIMAP similar genes for CTBP1 using alignment to 12 protein entries:     CTBP1_HUMAN (see all proteins):
    DKFZp434B0914    CTBP2

    CTBP1 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for CTBP1 (see all 777)    About this table    
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 4 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs131080061,2
    H--1212927(+) ccatcC/Ttgagc 2 -- int14Minor allele frequency- T:0.00NS EA 392
    rs2000131301,2
    --1212962(+) CAAAA-/AATAATAA 2 -- int10--------
    rs1151922011,2
    C,F--1212992(+) AATTTA/TAAAAA 2 -- int11Minor allele frequency- T:0.04WA 118
    rs1847600911,2
    --1213283(+) GGAAAC/TGTCCT 2 -- int10--------
    rs1134294471,2
    C,F--1213325(+) CCCACA/TTCAAC 2 -- int12Minor allele frequency- T:0.03CSA WA 120
    rs1894824461,2
    --1213363(+) GATGAC/TTGTAG 2 -- int10--------
    rs49745401,2
    C,F,A,H--1213463(+) tgacaC/Tagcag 2 -- int16Minor allele frequency- T:0.31NA WA EA 364
    rs1815676331,2
    --1213490(+) TTCAAA/GAGAAT 2 -- int10--------
    rs1853473681,2
    --1213549(+) AACTCC/TTGGTG 2 -- int10--------
    rs730699161,2
    C,F--1213554(+) CTGGTG/CATCCT 2 -- int12Minor allele frequency- C:0.08WA 120

    HapMap Linkage Disequilibrium report for CTBP1 (1205228 - 1243741 bp)

    Structural Variations
         Database of Genomic Variants (DGV) Selected variations for CTBP1 (see all 18):    About this table    
    Variant IDTypeSubtypePubMed ID
    esv2726769CNV Deletion23290073
    esv1720969CNV Insertion17803354
    esv1540743CNV Insertion17803354
    nsv508988CNV Insertion20534489
    dgv5401n71CNV Loss21882294
    esv27609CNV Loss19812545
    nsv822430CNV Loss20364138
    dgv5402n71CNV Loss21882294
    nsv878334CNV Loss21882294
    dgv5403n71CNV Loss21882294

    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing CTBP1
    DNA2.0 Custom Variant and Variant Library Synthesis for CTBP1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 602618    OMIM disorders: --

    Selected diseases for CTBP1 (see all 22):    
    About MalaCards
    familial adenomatous polyposis    holoprosencephaly    lymphopenia    chronic myeloid leukemia
    pituitary tumors    diabetic nephropathy    colorectal cancer    retinoblastoma
    hypoxia    myeloid leukemia    melanoma    adenoma
    hepatitis b    ataxia    breast cancer    hypertension
    leukemia    hepatitis    endotheliitis    prostate cancer


    CTBP1 for disorders           About GeneDecksing

    10 Novoseek inferred disease relationships for CTBP1 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    familial adenomatous polyposis 36 3 17028196 (2)
    colon cancer 31.6 1 19798104 (1)
    colorectal cancer 13.7 7 16547505 (3), 17028196 (1), 16510874 (1), 20383323 (1)
    tumors 12.9 15 16740659 (3), 16804902 (3), 18086895 (2), 15831459 (1) (see all 9)
    cancer 10.5 8 17662696 (2), 16547590 (1), 20372804 (1), 16740659 (1) (see all 7)
    colon carcinoma 2.09 3 16804902 (2), 15831101 (1)
    breast cancer 1.78 3 19744932 (1)
    carcinoma 0 2 19450512 (2)
    lymphoma 0 1 18212045 (1)
    melanoma 0 23 19216735 (7), 12384563 (3), 14702186 (1)

    Genetic Association Database (GAD): CTBP1
    Human Genome Epidemiology (HuGE) Navigator: CTBP1 (4 documents)

    Export disorders for CTBP1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for CTBP1 gene, integrated from 10 sources (see all 244):
    (articles sorted by number of sources associating them with CTBP1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. C-terminal binding protein is a transcriptional repressor that interacts with a specific class of vertebrate polycomb proteins. (PubMed id 9858600)1, 2, 9 Sewalt R.G.A.B....Otte A.P. (Mol. Cell. Biol. 1999)
    2. Acetylation-dependent interaction of SATB1 and CtBP1 mediates transcriptional repression by SATB1. (PubMed id 19103759)1, 2, 9 Purbey P.K.... Galande S. (Mol. Cell. Biol. 2009)
    3. Acetylation of nuclear hormone receptor-interacting protein RIP140 regulates binding of the transcriptional corepressor CtBP. (PubMed id 11509661)1, 2, 9 Vo N.... Goodman R.H. (Mol. Cell. Biol. 2001)
    4. CtBP is an essential corepressor for BCL6 autoregulation. (PubMed id 18212045)1, 2, 9 Mendez L.M....Ye B.H. (Mol. Cell. Biol. 2008)
    5. The polycomb protein Pc2 is a SUMO E3. (PubMed id 12679040)1, 2, 9 Kagey M.H.... Wotton D. (Cell 2003)
    6. Transcription corepressor CtBP is an NAD(+)-regulated dehydrogenase. (PubMed id 12419229)1, 2, 9 Kumar V.... Aggarwal A.K. (Mol. Cell 2002)
    7. Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene. (PubMed id 15542832)1, 2, 9 Alpatov R.... Sugrue S.P. (Mol. Cell. Biol. 2004)
    8. A novel C-terminal binding protein (CTBP2) is closely related to CTBP1, an adenovirus E1A-binding protein, and maps to human chromosome 21q21.3. (PubMed id 9479502)1, 3, 9 Katsanis N. and Fisher E.M.C. (Genomics 1998)
    9. A region in the C-terminus of adenovirus 2/5 E1a protein is required for association with a cellular phosphoprotein and important for the negative modulation of T24-ras mediated transformation, tumorigenesis and metastasis. (PubMed id 8440238)1, 2, 9 Boyd J.M....Chinnadurai G. (EMBO J. 1993)
    10. Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin. (PubMed id 16061479)1, 2, 9 Long J.... Park M. (J. Biol. Chem. 2005)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 1487 HGNC: 2494 AceView: CTBP1 Ensembl:ENSG00000159692 euGenes: HUgn1487
    ECgene: CTBP1 Kegg: 1487 H-InvDB: CTBP1

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for CTBP1 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for CTBP1 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for CTBP1 gene:
    Search GeneIP for patents involving CTBP1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, and ESI BIO, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     EMD Millipore Mono- and Polyclonal Antibodies for the study of CTBP1
     Browse Small Molecules at EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     Browse Purified and Recombinant Proteins at EMD Millipore
     
     EMD Millipore genomic analysis products

      
     Antibodies for CTBP1 (CtBP1)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Recombinant/Natural Proteins   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     OriGene Antibodies for CTBP1   OriGene RNAi products in human, mouse, rat for CTBP1  
     OriGene qPCR primer pairs and template standards for CTBP1   OriGene Protein Over-expression Lysate for CTBP1  
     OriGene MassSpec something-or-other for CTBP1   OriGene clones in human, mouse for CTBP1  
     OriGene qSTAR qPCR primer pairs in human, mouse for CTBP1   OriGene Purified Protein for CTBP1  
     OriGene ORF clones in mouse, rat for CTBP1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for CTBP1   OriGene Custom Protein Services for CTBP1  

     
     
     Block miRNA regulation of human, mouse, rat CTBP1 using miScript Target Protectors SeqTarget long-range PCR primers for resequencing CTBP1
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat CTBP1 Predesigned siRNA for gene silencing in human, mouse, rat CTBP1
     QuantiFast Probe-based Assays in human, mouse, rat CTBP1 QuantiTect SYBR Green Assays in human, mouse, rat CTBP1
     PCR Arrays including human, mouse, rat CTBP1 Search Chromatin IP Primers for CTBP1
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat CTBP1  GeneGlobe Interaction Network for CTBP1
     Regulatory tfbs in CTBP1 promoter
     GenScript Custom Purified and Recombinant Proteins Services for CTBP1 GenScript cDNA clones with any tag delivered in your preferred vector for CTBP1
     GenScript Custom Assay Services for CTBP1 GenScript Custom overexpressing Cell Line Services for CTBP1
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Antibodies & Assays for CTBP1 

     Search Tocris compounds for CTBP1
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     cDNA Clones for CTBP1
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     CTBP1 antibodies
     CTBP1 proteins
     CTBP1 lysates
     Antibodies for CTBP1
     See all of Abcam's Antibodies, Kits and Proteins for CTBP1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for CTBP1
     Proteins for CTBP1
     Antibodies for CTBP1
     ELISAs for CTBP1
     CLIAs for CTBP1



     Browse ESI BIO Cell Lines and PureStem Progenitors for CTBP1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for CTBP1
     SwitchGear 3'UTR luciferase reporter plasmids for CTBP1
     SwitchGear Promoter luciferase reporter plasmids for CTBP1
     ThermoFisher Antibody for CTBP1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat CTBP1
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for CTBP1
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for CTBP1
     LSBio Antibodies in human, mouse, rat for CTBP1
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      CTBP1 gene at Home site.
    Version: 3.12.142 28 July 2014
    hostname: 356977-web1.xennexinc.com index build: 126 solr: 1.4