Free for academic non-profit institutions. Other users need a Commercial license

CSNK2A2 Gene(Protein Coding)

Casein Kinase 2 Alpha 2

GCID:
GC16M058191
GIFtS:
68
Genes Participants
UDN Logo

Aliases for CSNK2A2 Gene

Aliases for CSNK2A2 Gene

  • Casein Kinase 2 Alpha 2 2 3 5
  • Casein Kinase 2, Alpha Prime Polypeptide 2 3
  • Casein Kinase 2 Alpha 2 3
  • CK II Alpha 3 4
  • EC 2.7.11.1 4 61
  • CK2A2 3 4
  • Casein Kinase II Subunit Alpha 3
  • EC 2.7.11 61
  • CK2alpha 3
  • CSNK2A1 3

External Ids for CSNK2A2 Gene

Previous GeneCards Identifiers for CSNK2A2 Gene

  • GC16M048586
  • GC16M058275
  • GC16M057926
  • GC16M057967
  • GC16M056749
  • GC16M044059

Summaries for CSNK2A2 Gene

GeneCards Summary for CSNK2A2 Gene

CSNK2A2 (Casein Kinase 2 Alpha 2) is a Protein Coding gene. Diseases associated with CSNK2A2 include Theileriasis and Spermatogenic Failure 6. Among its related pathways are Regulation of TP53 Activity and DNA damage_NHEJ mechanisms of DSBs repair. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CSNK2A3.

UniProtKB/Swiss-Prot for CSNK2A2 Gene

  • Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating Ser-392 of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.

Tocris Summary for CSNK2A2 Gene

  • Casein kinase II (CK2) is a constitutively active, ubiquitously expressed serine/threonine protein kinase thought to have a regulatory function in cell proliferation, differentiation and apoptosis. CK2 functions as a tetrameric complex with 2 regulatory and 2 catalytic subunits.

Gene Wiki entry for CSNK2A2 Gene

No data available for Entrez Gene Summary , CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CSNK2A2 Gene

Genomics for CSNK2A2 Gene

Products:

  1. Regulatory Element

Regulatory Elements for CSNK2A2 Gene

Enhancers for CSNK2A2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH16G057645 1.9 FANTOM5 Ensembl ENCODE dbSUPER 10.2 +550.5 550474 4.7 HDGF HNRNPUL1 PKNOX1 MLX ARNT ZFP64 WRNIP1 ARID4B SIN3A ZNF2 RSPRY1 KATNB1 SETD6 CSNK2A2 ADGRG5 CFAP20 GC16P057639 GC16M057649
GH16G058236 1.2 Ensembl ENCODE 15.9 -38.7 -38654 1.1 FOXA2 ATF1 RB1 CREB3L1 ZNF76 ZEB1 YY1 ETS1 SCRT2 ZNF143 CSNK2A2 LOC105371293 RN7SL645P
GH16G057298 1.7 Ensembl ENCODE dbSUPER 10.2 +897.8 897841 2.8 DMAP1 YY1 SLC30A9 ZNF143 SP3 NFYC PPARGC1A MEF2D SSRP1 ZNF610 POLR2C RSPRY1 CCL22 CX3CL1 ARL2BP CIAPIN1 COQ9 CSNK2A2 LOC101927556 PLLP
GH16G058021 1.6 Ensembl ENCODE dbSUPER 10.7 +172.5 172461 7.1 PKNOX1 MLX AGO1 ZFP64 ARID4B SIN3A FEZF1 DMAP1 YY1 SLC30A9 TEPP CFAP20 CNGB1 CSNK2A2 ZNF319 MMP15 GC16P058028
GH16G057281 1.6 Ensembl ENCODE dbSUPER 10.2 +914.4 914409 3.3 HDGF HNRNPUL1 MLX CREB3L1 ZFP64 ARID4B SIN3A SLC30A9 ZNF143 FOS RSPRY1 PLLP LOC101927556 POLR2C CSNK2A2 FAM192A ENSG00000260038
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CSNK2A2 on UCSC Golden Path with GeneCards custom track

Promoters for CSNK2A2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000086548 20 1401 HDGF PKNOX1 GLIS2 ZNF143 KLF7 ZNF548 KDM4B SP3 SP5 YY2

Transcription factor binding sites by QIAGEN in the CSNK2A2 gene promoter:

Genomic Location for CSNK2A2 Gene

Chromosome:
16
Start:
58,157,907 bp from pter
End:
58,197,920 bp from pter
Size:
40,014 bases
Orientation:
Minus strand

Genomic View for CSNK2A2 Gene

Genes around CSNK2A2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CSNK2A2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CSNK2A2 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for CSNK2A2 Gene

Proteins for CSNK2A2 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for CSNK2A2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P19784-CSK22_HUMAN
    Recommended name:
    Casein kinase II subunit alpha
    Protein Accession:
    P19784

    Protein attributes for CSNK2A2 Gene

    Size:
    350 amino acids
    Molecular mass:
    41213 Da
    Quaternary structure:
    • Heterotetramer composed of two catalytic subunits (alpha chain and/or alpha chain) and two regulatory subunits (beta chains). The tetramer can exist as a combination of 2 alpha/2 beta, 2 alpha/2 beta or 1 alpha/1 alpha/2 beta subunits. Also part of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, which forms following UV irradiation. Interacts with RNPS1.
    Miscellaneous:
    • Can use both ATP and GTP as phosphoryl donors. Phosphorylation by casein kinase 2 has been estimated to represent up to one quarter of the eukaryotic phosphoproteome.

    Three dimensional structures from OCA and Proteopedia for CSNK2A2 Gene

neXtProt entry for CSNK2A2 Gene

Protein Expression for CSNK2A2 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for CSNK2A2 Gene

P19784:
  • LDKLLRYDHQ
  • LIDWGLAE
  • GIMHRDVKPHNVMID
  • LDPHFNDILGQHSRKRWENFIHSENRHLVSPE
  • EAMEHPYFY
  • LKALDYCHS
  • GRGKYSEVF
  • REYWDYE
  • DNYDQLV
  • KILENLRGG
  • DIRFYMYE
  • YQLVRKL
  • YNVRVASR
  • EVFEAIN
  • SRARVYAEVN
  • IAKVLGT
  • KKKIKRE
  • YDYSLDMWSLGC
  • MLASMIF
  • YELLKALD
  • TPALVFE

Post-translational modifications for CSNK2A2 Gene

  • Ubiquitination at Lys304
  • Modification sites at PhosphoSitePlus

Other Protein References for CSNK2A2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for CSNK2A2 Gene

Gene Families for CSNK2A2 Gene

IUPHAR :

Protein Domains for CSNK2A2 Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for CSNK2A2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P19784

UniProtKB/Swiss-Prot:

CSK22_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.
genes like me logo Genes that share domains with CSNK2A2: view

Function for CSNK2A2 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for CSNK2A2 Gene

GENATLAS Biochemistry:
casein kinase II,catalytic unit,alpha 2,likely involved in regulation of cell growth,ubiquitous
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Constitutively active protein kinase whose activity is not directly affected by phosphorylation. Seems to be regulated by level of expression and localization (By similarity).
UniProtKB/Swiss-Prot Function:
Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating Ser-392 of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.

Enzyme Numbers (IUBMB) for CSNK2A2 Gene

Gene Ontology (GO) - Molecular Function for CSNK2A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 10094392
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with CSNK2A2: view
genes like me logo Genes that share phenotypes with CSNK2A2: view

Animal Models for CSNK2A2 Gene

MGI Knock Outs for CSNK2A2:

Animal Model Products

  • Taconic Biosciences Mouse Models for CSNK2A2

miRNA for CSNK2A2 Gene

miRTarBase miRNAs that target CSNK2A2

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CSNK2A2 Gene

Localization for CSNK2A2 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CSNK2A2 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 2

Gene Ontology (GO) - Cellular Components for CSNK2A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000785 chromatin IEA --
GO:0001669 acrosomal vesicle IEA --
GO:0005634 nucleus IDA 21282530
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with CSNK2A2: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for CSNK2A2 Gene

Pathways & Interactions for CSNK2A2 Gene

genes like me logo Genes that share pathways with CSNK2A2: view

Pathways by source for CSNK2A2 Gene

1 BioSystems pathway for CSNK2A2 Gene
1 R&D Systems pathway for CSNK2A2 Gene
1 Tocris pathway for CSNK2A2 Gene

SIGNOR curated interactions for CSNK2A2 Gene

Activates:
Inactivates:
Other effect:

Gene Ontology (GO) - Biological Process for CSNK2A2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006351 transcription, DNA-templated IEA --
GO:0006355 regulation of transcription, DNA-templated IEA --
GO:0006457 protein folding TAS --
GO:0006468 protein phosphorylation IEA --
GO:0006656 phosphatidylcholine biosynthetic process TAS --
genes like me logo Genes that share ontologies with CSNK2A2: view

Drugs & Compounds for CSNK2A2 Gene

Products:

  1. Drug

(55) Drugs for CSNK2A2 Gene - From: DrugBank, ApexBio, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
[1-(6-{6-[(1-methylethyl)amino]-1H-indazol-1-yl}pyrazin-2-yl)-1H-pyrrol-3-yl]acetic acid Experimental Pharma Target 0
Ellagic acid Investigational Pharma Casein kinase 2 (CK2) inhibitor, Selective inhibitor of CK2. Also inhibits glutathione S-transferase 0
TBB Pharma Casein kinase-2 (CK2) inhibitor, Selective cell-permeable CK2 inhibitor 0
TTP 22 Pharma CK2 inhibitor, High affinity, selective CK2 inhibitor 0

(30) Additional Compounds for CSNK2A2 Gene - From: Novoseek, Tocris, and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
TBCA
934358-00-6

(5) Tocris Compounds for CSNK2A2 Gene

Compound Action Cas Number
Ellagic acid Selective inhibitor of CK2. Also inhibits glutathione S-transferase 476-66-4
TBB Selective cell-permeable CK2 inhibitor 17374-26-4
TBCA Selective CK2 inhibitor 934358-00-6
TMCB Dual-kinase inhibitor; inhibits CK2 and ERK8 905105-89-7
TTP 22 High affinity, selective CK2 inhibitor 329907-28-0

(6) ApexBio Compounds for CSNK2A2 Gene

Compound Action Cas Number
CX-4945 (Silmitasertib) CK2 inhibitor 1009820-21-6
CX-4945 sodium salt 1309357-15-0
DMAT CK2 inhibitor,potent and selective 749234-11-5
Ellagic acid Casein kinase 2 (CK2) inhibitor 476-66-4
TBB Casein kinase-2 (CK2) inhibitor 17374-26-4
TTP 22 CK2 inhibitor 329907-28-0
genes like me logo Genes that share compounds with CSNK2A2: view

Transcripts for CSNK2A2 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for CSNK2A2 Gene

(4) REFSEQ mRNAs :
(5) Additional mRNA sequences :
(333) Selected AceView cDNA sequences:
(6) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for CSNK2A2 Gene

Casein kinase 2, alpha prime polypeptide:
Representative Sequences:

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for CSNK2A2 Gene

No ASD Table

Relevant External Links for CSNK2A2 Gene

GeneLoc Exon Structure for
CSNK2A2
ECgene alternative splicing isoforms for
CSNK2A2

Expression for CSNK2A2 Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CSNK2A2 Gene

mRNA expression in normal human tissues for CSNK2A2 Gene
mRNA expression by BioGPS for CSNK2A2 GenemRNA expression by GTEx for CSNK2A2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for CSNK2A2 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CSNK2A2 Gene



Protein tissue co-expression partners for CSNK2A2 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of CSNK2A2 Gene:

CSNK2A2

SOURCE GeneReport for Unigene cluster for CSNK2A2 Gene:

Hs.82201

Evidence on tissue expression from TISSUES for CSNK2A2 Gene

  • Nervous system(3.3)
genes like me logo Genes that share expression patterns with CSNK2A2: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for CSNK2A2 Gene

Orthologs for CSNK2A2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for CSNK2A2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia CSNK2A2 34 35
  • 99.58 (n)
oppossum
(Monodelphis domestica)
 Mammalia CSNK2A2 35
  • 98 (a)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia CSNK2A2 35
  • 98 (a)
 OneToOne
dog
(Canis familiaris)
 Mammalia CSNK2A2 34 35
  • 95.68 (n)
cow
(Bos Taurus)
 Mammalia CSNK2A2 34 35
  • 95.52 (n)
mouse
(Mus musculus)
 Mammalia Csnk2a2 34 16 35
  • 94.86 (n)
rat
(Rattus norvegicus)
 Mammalia Csnk2a2 34
  • 94.38 (n)
chicken
(Gallus gallus)
 Aves CSNK2A2 34 35
  • 86.57 (n)
lizard
(Anolis carolinensis)
 Reptilia CSNK2A2 35
  • 95 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia Str.6473 34
African clawed frog
(Xenopus laevis)
 Amphibia Xl.2127 34
zebrafish
(Danio rerio)
 Actinopterygii ck2a2a 35
  • 81 (a)
 OneToMany
ck2a2b 34 35
  • 76.1 (n)
ck2a2 34
rainbow trout
(Oncorhynchus mykiss)
 Actinopterygii Omy.5116 34
fruit fly
(Drosophila melanogaster)
 Insecta CkIIalpha 36
  • 81 (a)
worm
(Caenorhabditis elegans)
 Secernentea B0205.7 36
  • 79 (a)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes CKA1 34
  • 62.29 (n)
CKA2 35
  • 56 (a)
 OneToMany
K. lactis yeast
(Kluyveromyces lactis)
 Saccharomycetes KLLA0E04247g 34
  • 61.04 (n)
A. gosspyii yeast
(Ashbya gossypii)
 Saccharomycetes AGOS_ADL102C 34
  • 60.21 (n)
thale cress
(Arabidopsis thaliana)
 eudicotyledons AT2G23080 34
  • 67.38 (n)
Alicante grape
(Vitis vinifera)
 eudicotyledons Vvi.10019 34
rice
(Oryza sativa)
 Liliopsida Os03g0207300 34
  • 69.16 (n)
Os.1955 34
barley
(Hordeum vulgare)
 Liliopsida Hv.3941 34
wheat
(Triticum aestivum)
 Liliopsida Ta.181 34
corn
(Zea mays)
 Liliopsida Zm.569 34
Species where no ortholog for CSNK2A2 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for CSNK2A2 Gene

ENSEMBL:
Gene Tree for CSNK2A2 (if available)
TreeFam:
Gene Tree for CSNK2A2 (if available)

Paralogs for CSNK2A2 Gene

Paralogs for CSNK2A2 Gene

(15) SIMAP similar genes for CSNK2A2 Gene using alignment to 4 proteins:

genes like me logo Genes that share paralogs with CSNK2A2: view

Variants for CSNK2A2 Gene

Sequence variations from dbSNP and Humsavar for CSNK2A2 Gene

SNP ID Clin Chr 16 pos Sequence Context AA Info Type
rs1000022059 -- 58,196,472(+) TTAAA(A/G)ATAGC intron-variant, upstream-variant-2KB
rs1000136006 -- 58,158,106(+) CATAC(C/T)CTTCA intron-variant, utr-variant-3-prime
rs1000136449 -- 58,196,667(+) TGACT(A/G)GGGTA intron-variant, upstream-variant-2KB
rs1000153042 -- 58,187,965(+) TATAA(C/T)AGCAG intron-variant
rs1000242697 -- 58,160,362(+) CACAG(C/T)AACAC intron-variant, nc-transcript-variant

Structural Variations from Database of Genomic Variants (DGV) for CSNK2A2 Gene

Variant ID Type Subtype PubMed ID
esv23104 CNV loss 19812545
esv2659878 CNV deletion 23128226
esv2665560 CNV deletion 23128226
esv3361478 CNV insertion 20981092
esv3553488 CNV deletion 23714750
esv3638719 CNV gain 21293372
esv3638722 CNV loss 21293372
esv3638723 CNV loss 21293372
nsv1143823 CNV deletion 24896259
nsv457491 CNV loss 19166990
nsv572763 CNV loss 21841781
nsv819431 CNV loss 19587683

Variation tolerance for CSNK2A2 Gene

Residual Variation Intolerance Score: 50.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.37; 8.17% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CSNK2A2 Gene

Human Gene Mutation Database (HGMD)
CSNK2A2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CSNK2A2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CSNK2A2 Gene

Disorders for CSNK2A2 Gene

MalaCards: The human disease database

(2) MalaCards diseases for CSNK2A2 Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
theileriasis
  • infection by theileria
spermatogenic failure 6
  • spermatogenic failure 9
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for CSNK2A2

Genetic Association Database (GAD)
CSNK2A2
Human Genome Epidemiology (HuGE) Navigator
CSNK2A2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CSNK2A2
genes like me logo Genes that share disorders with CSNK2A2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CSNK2A2 Gene

Publications for CSNK2A2 Gene

  1. Isolation and characterization of human cDNA clones encoding the alpha and the alpha' subunits of casein kinase II. (PMID: 2174700) Lozeman F.J. … Krebs E.G. (Biochemistry 1990) 2 3 4 22 64
  2. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  3. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  5. p53 serine 392 phosphorylation increases after UV through induction of the assembly of the CK2.hSPT16.SSRP1 complex. (PMID: 12393879) Keller D.M. … Lu H. (J. Biol. Chem. 2002) 3 4 64

Products for CSNK2A2 Gene

Sources for CSNK2A2 Gene

Content
Loading form....