Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CSK Gene

Aliases for CSK Gene

  • C-Terminal Src Kinase 2 3
  • C-Src Tyrosine Kinase 2 5
  • EC 2.7.10.2 4 61
  • CSK, Non-Receptor Tyrosine Kinase 2
  • Protein-Tyrosine Kinase CYL 4
  • C-Src Kinase 4
  • EC 2.7.10 61

External Ids for CSK Gene

Previous GeneCards Identifiers for CSK Gene

  • GC15M070982
  • GC15M068251
  • GC15P072650
  • GC15P072790
  • GC15P072861
  • GC15P075075
  • GC15P051872

Summaries for CSK Gene

GeneCards Summary for CSK Gene

CSK (C-Terminal Src Kinase) is a Protein Coding gene. Diseases associated with CSK include Colorectal Cancer and Breast Cancer. Among its related pathways are RET signaling and Development ERBB-family signaling. GO annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is MATK.

UniProtKB/Swiss-Prot for CSK Gene

  • Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.

Gene Wiki entry for CSK Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CSK Gene

Genomics for CSK Gene

Regulatory Elements for CSK Gene

Enhancers for CSK Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G074775 2.1 FANTOM5 Ensembl ENCODE dbSUPER 18 +6.1 6117 26.0 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 TBX21 MEF2D GLIS1 RCOR2 ULK3 C15orf39 DNM1P35 EDC3 ENSG00000203392 CSK RPP25 CPLX3 LMAN1L ENSG00000260274
GH15G074373 1.6 FANTOM5 ENCODE dbSUPER 15 -407.9 -407855 2.0 PKNOX1 ARNT ARID4B SIN3A ZNF2 ZNF143 ZNF207 FOS DEK ZNF263 CSK SEMA7A UBL7-AS1 UBL7 ARID3B ENSG00000212279 CYP11A1 SCAMP2 LOC729739 ISLR
GH15G074361 1 ENCODE 15.8 -416.2 -416164 9.0 PKNOX1 ATF1 ZFP64 FEZF1 ZNF48 ELK1 FOS ZHX2 TSHZ1 SMARCB1 CSK ISLR SEMA7A UBL7-AS1 UBL7 ENSG00000212279 ARID3B CYP11A1 SCAMP5 LOC729739
GH15G074953 1.5 FANTOM5 ENCODE 10.5 +174.6 174600 5.4 PKNOX1 CREB3L1 ARNT SIN3A DMAP1 YY1 ZNF766 ZNF207 FOS ZNF263 RPP25 FAM219B MPI ULK3 SCAMP2 CPLX3 CSK SCAMP5 COX5A
GH15G074614 1.4 ENCODE dbSUPER 11.2 -165.7 -165744 4.9 MLX CREB3L1 AGO1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 NFYC EDC3 ARID3B ISLR CSK PTPN9 CYP1A1 ENSG00000212279 ULK3 UBL7 UBL7-AS1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CSK on UCSC Golden Path with GeneCards custom track

Promoters for CSK Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000079299 743 2001 ARNT WRNIP1 ARID4B SIN3A DMAP1 GLI4 ZNF2 ZBTB7B SLC30A9 GLIS2

Genomic Location for CSK Gene

Chromosome:
15
Start:
74,782,057 bp from pter
End:
74,803,198 bp from pter
Size:
21,142 bases
Orientation:
Plus strand

Genomic View for CSK Gene

Genes around CSK on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CSK Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CSK Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CSK Gene

Proteins for CSK Gene

  • Protein details for CSK Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P41240-CSK_HUMAN
    Recommended name:
    Tyrosine-protein kinase CSK
    Protein Accession:
    P41240
    Secondary Accessions:
    • Q2M3N2
    • Q6FGZ6

    Protein attributes for CSK Gene

    Size:
    450 amino acids
    Molecular mass:
    50704 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Homodimer (via SH3-domain) (PubMed:19888460). Interacts with PTPN22 (PubMed:15208781). Interacts with phosphorylated SIT1, PAG1, LIME1 and TGFB1I1; these interactions serve to recruit CSK to the membrane where it can phosphorylate and inhibit Src-family kinases (PubMed:11433379, PubMed:10790433, PubMed:14610046, PubMed:10838081). Interacts with SRCIN1 (PubMed:17525734). Interacts with RHOH (PubMed:20851766). Interacts (via SH2 domain) with SCIMP (PubMed:21930792).

    Three dimensional structures from OCA and Proteopedia for CSK Gene

neXtProt entry for CSK Gene

Selected DME Specific Peptides for CSK Gene

P41240:
  • RDLAARN
  • PPETGLFLVRESTNYPGDYTLCVSC
  • WPSGTECIAKYNFHGTAEQDLPF
  • KWTAPEA
  • IGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
  • EAMEYLE
  • KGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGV
  • AARNVLV
  • KLSLMPWFHGKI
  • KSDVWSFG
  • LKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFL
  • FVHRDLA
  • NFVHRDLAARNVL
  • RLIKPKVMEGTVAAQDEF
  • HGKITRE
  • RSGWALNMK

Post-translational modifications for CSK Gene

  • Phosphorylated at Ser-364 by PKA, leading to increased activity. Autophosphorylated.
  • Ubiquitination at isoforms=193, Lys196, Lys329, and isoforms=337
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for CSK (CSK)

Domains & Families for CSK Gene

Gene Families for CSK Gene

Graphical View of Domain Structure for InterPro Entry

P41240

UniProtKB/Swiss-Prot:

CSK_HUMAN :
  • The architecture of this protein is similar to that of Src-family kinases (SFKs) with one N-terminal SH3 domain, one SH2 domain, and a C-terminal kinase domain.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. CSK subfamily.
Domain:
  • The architecture of this protein is similar to that of Src-family kinases (SFKs) with one N-terminal SH3 domain, one SH2 domain, and a C-terminal kinase domain.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. CSK subfamily.
genes like me logo Genes that share domains with CSK: view

Function for CSK Gene

Molecular function for CSK Gene

GENATLAS Biochemistry:
tyrosine kinase,SRC downregulating (putative antioncogene)
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot Function:
Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.

Enzyme Numbers (IUBMB) for CSK Gene

Gene Ontology (GO) - Molecular Function for CSK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004713 protein tyrosine kinase activity TAS --
GO:0004715 non-membrane spanning protein tyrosine kinase activity IBA --
GO:0005102 receptor binding IBA --
GO:0005515 protein binding IPI 7507203
genes like me logo Genes that share ontologies with CSK: view

Phenotypes for CSK Gene

MGI mutant phenotypes for CSK:
inferred from 5 alleles
GenomeRNAi human phenotypes for CSK:
genes like me logo Genes that share phenotypes with CSK: view

Animal Models for CSK Gene

MGI Knock Outs for CSK:

Animal Model Products

CRISPR Products

miRNA for CSK Gene

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for CSK
  • Applied Biological Materials Clones for CSK

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CSK Gene

Localization for CSK Gene

Subcellular locations from UniProtKB/Swiss-Prot for CSK Gene

Cytoplasm. Cell membrane. Note=Mainly cytoplasmic, also present in lipid rafts. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CSK gene
Compartment Confidence
plasma membrane 5
extracellular 5
cytosol 5
cytoskeleton 3
nucleus 2
golgi apparatus 2
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1
endosome 1

Gene Ontology (GO) - Cellular Components for CSK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm TAS 8890164
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane TAS --
GO:0005911 cell-cell junction IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with CSK: view

Pathways & Interactions for CSK Gene

SuperPathway Contained pathways
1 RET signaling
2 Signaling by moderate kinase activity BRAF mutants
3 Development ERBB-family signaling
4 ICos-ICosL Pathway in T-Helper Cell
5 Developmental Biology
genes like me logo Genes that share pathways with CSK: view

SIGNOR curated interactions for CSK Gene

Activates:
Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for CSK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001817 regulation of cytokine production IBA --
GO:0002250 adaptive immune response IEA --
GO:0002376 immune system process IEA --
GO:0006468 protein phosphorylation TAS 1945408
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IBA --
genes like me logo Genes that share ontologies with CSK: view

Drugs & Compounds for CSK Gene

(37) Drugs for CSK Gene - From: DrugBank, ApexBio, DGIdb, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Staurosporine Experimental Pharma Positive, Allosteric regulator, Target Protein kinase inhibitor,potent and cell permeable 47
TG100801 Investigational Pharma Target 0
apatinib Pharma inhibitor VEGFR2 inhibitor, orally bioavailable, selective, Kinase Inhibitors 0
PP 1 Pharma Src family tyrosine kinase inhibitor, Potent, selective Src family kinase inhibitor 0
PP 2 (AG 1879) Pharma Src-family kinases inhibitor 0

(27) Additional Compounds for CSK Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(3) ApexBio Compounds for CSK Gene

Compound Action Cas Number
Apatinib VEGFR2 inhibitor, orally bioavailable, selective 811803-05-1
PP 1 Src family tyrosine kinase inhibitor 172889-26-8
PP 2 (AG 1879) Src-family kinases inhibitor 172889-27-9
genes like me logo Genes that share compounds with CSK: view

Drug Products

Transcripts for CSK Gene

Unigene Clusters for CSK Gene

C-src tyrosine kinase:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for CSK
  • Applied Biological Materials Clones for CSK

Alternative Splicing Database (ASD) splice patterns (SP) for CSK Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7a · 7b ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14a · 14b · 14c ^ 15 ^ 16a · 16b · 16c ·
SP1: - - - -
SP2: - - - - - - -
SP3: - - - - - - - -
SP4: - -
SP5: -
SP6: -
SP7: -
SP8:
SP9:
SP10: - - -

ExUns: 16d ^ 17a · 17b ^ 18a · 18b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:

Relevant External Links for CSK Gene

GeneLoc Exon Structure for
CSK
ECgene alternative splicing isoforms for
CSK

Expression for CSK Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CSK Gene

mRNA differential expression in normal tissues according to GTEx for CSK Gene

This gene is overexpressed in Whole Blood (x10.8).

Protein differential expression in normal tissues from HIPED for CSK Gene

This gene is overexpressed in Peripheral blood mononuclear cells (14.8), Lymph node (8.4), and Tlymphocyte (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CSK Gene



Protein tissue co-expression partners for CSK Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of CSK Gene:

CSK

SOURCE GeneReport for Unigene cluster for CSK Gene:

Hs.77793

mRNA Expression by UniProt/SwissProt for CSK Gene:

P41240-CSK_HUMAN
Tissue specificity: Expressed in lung and macrophages.

Evidence on tissue expression from TISSUES for CSK Gene

  • Nervous system(4.7)
  • Lung(4.5)
  • Blood(3.8)
  • Skin(3.2)
  • Intestine(2.6)
  • Heart(2.2)
  • Muscle(2.2)
  • Kidney(2)
  • Lymph node(2)
genes like me logo Genes that share expression patterns with CSK: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for CSK Gene

Orthologs for CSK Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for CSK Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CSK 34 35
  • 98.3 (n)
oppossum
(Monodelphis domestica)
Mammalia CSK 35
  • 96 (a)
OneToOne
dog
(Canis familiaris)
Mammalia CSK 34 35
  • 93.41 (n)
cow
(Bos Taurus)
Mammalia CSK 34 35
  • 93.04 (n)
rat
(Rattus norvegicus)
Mammalia Csk 34
  • 90.22 (n)
mouse
(Mus musculus)
Mammalia Csk 34 16 35
  • 90.07 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 20 (a)
ManyToMany
chicken
(Gallus gallus)
Aves CSK 34 35
  • 84.59 (n)
lizard
(Anolis carolinensis)
Reptilia CSK 35
  • 93 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia csk 34
  • 74.63 (n)
African clawed frog
(Xenopus laevis)
Amphibia csk-A 34
zebrafish
(Danio rerio)
Actinopterygii CSK (1 of 2) 35
  • 84 (a)
OneToMany
csk 34 35
  • 77.88 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9844 34
fruit fly
(Drosophila melanogaster)
Insecta Csk 36 34 35
  • 64.74 (n)
worm
(Caenorhabditis elegans)
Secernentea csk-1 34 35
  • 53.38 (n)
Y38H6C.20 36
  • 31 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CDC15 35
  • 8 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.5205 35
  • 50 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.9183 34
Species where no ortholog for CSK was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CSK Gene

ENSEMBL:
Gene Tree for CSK (if available)
TreeFam:
Gene Tree for CSK (if available)

Paralogs for CSK Gene

Variants for CSK Gene

Sequence variations from dbSNP and Humsavar for CSK Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
rs1000000020 -- 74,801,449(+) CACCC(A/G)GCCCC intron-variant
rs1000151677 -- 74,781,564(+) GTTAG(A/C)CCTAG upstream-variant-2KB
rs1000237174 -- 74,787,017(+) CCCAA(G/T)ATGCT intron-variant
rs1000344503 -- 74,793,263(+) TTAGC(A/C)CTCTT intron-variant
rs1000384307 -- 74,788,984(+) AGAAA(A/C)CTTTC intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for CSK Gene

Variant ID Type Subtype PubMed ID
dgv307e201 CNV deletion 23290073
esv2749883 CNV deletion 23290073
esv2749886 CNV deletion 23290073
esv3636909 CNV loss 21293372
nsv1069866 CNV deletion 25765185
nsv1118322 CNV deletion 24896259
nsv1121512 CNV deletion 24896259
nsv833055 CNV loss 17160897

Variation tolerance for CSK Gene

Residual Variation Intolerance Score: 22.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.06; 37.79% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CSK Gene

Human Gene Mutation Database (HGMD)
CSK
SNPedia medical, phenotypic, and genealogical associations of SNPs for
CSK

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CSK Gene

Disorders for CSK Gene

MalaCards: The human disease database

(2) MalaCards diseases for CSK Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
colorectal cancer
  • colorectal cancer, somatic
breast cancer
  • breast cancer, invasive ductal
- elite association - COSMIC cancer census association via MalaCards
Search CSK in MalaCards View complete list of genes associated with diseases

Relevant External Links for CSK

Genetic Association Database (GAD)
CSK
Human Genome Epidemiology (HuGE) Navigator
CSK
Tumor Gene Database (TGDB):
CSK
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CSK
genes like me logo Genes that share disorders with CSK: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CSK Gene

Publications for CSK Gene

  1. Activation of the COOH-terminal Src kinase (Csk) by cAMP-dependent protein kinase inhibits signaling through the T cell receptor. (PMID: 11181701) Vang T. … Tasken K. (J. Exp. Med. 2001) 3 4 22 64
  2. Identification of csk tyrosine phosphorylation sites and a tyrosine residue important for kinase domain structure. (PMID: 9148770) Joukov V. … Bergman M. (Biochem. J. 1997) 3 4 22 64
  3. The c-src tyrosine kinase (CSK) gene, a potential antioncogene, localizes to human chromosome region 15q23----q25. (PMID: 1377109) Armstrong E. … Alitalo K. (Cytogenet. Cell Genet. 1992) 2 3 22 64
  4. SCIMP, a transmembrane adapter protein involved in major histocompatibility complex class II signaling. (PMID: 21930792) Draber P. … Brdicka T. (Mol. Cell. Biol. 2011) 3 4 64
  5. Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure. (PMID: 21909110) Wain L.V. … van Duijn C.M. (Nat. Genet. 2011) 3 46 64

Products for CSK Gene

  • Addgene plasmids for CSK

Sources for CSK Gene

Content
Loading form....