Free for academic non-profit institutions. Other users need a Commercial license

Aliases for CPD Gene

Aliases for CPD Gene

  • Carboxypeptidase D 2 3 5
  • Metallocarboxypeptidase D 2 3 4
  • EC 3.4.17.22 4 61
  • GP180 3 4
  • EC 3.4.17 61

External Ids for CPD Gene

Previous GeneCards Identifiers for CPD Gene

  • GC17P028459
  • GC17P030612
  • GC17P028851
  • GC17P025730
  • GC17P028705
  • GC17P024916

Summaries for CPD Gene

Entrez Gene Summary for CPD Gene

  • The metallocarboxypeptidase family of enzymes is divided into 2 subfamilies based on sequence similarities. The pancreatic carboxypeptidase-like and the regulatory B-type carboxypeptidase subfamilies. Carboxypeptidase D has been identified as a regulatory B-type carboxypeptidase. CPD is a homolog of duck gp180, a hepatitis B virus-binding protein. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for CPD Gene

CPD (Carboxypeptidase D) is a Protein Coding gene. Diseases associated with CPD include Hepatitis B. Among its related pathways are Vesicle-mediated transport and Clathrin derived vesicle budding. GO annotations related to this gene include metallocarboxypeptidase activity and serine-type carboxypeptidase activity. An important paralog of this gene is MIR4649.

Gene Wiki entry for CPD Gene

No data available for UniProtKB/Swiss-Prot , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CPD Gene

Genomics for CPD Gene

Regulatory Elements for CPD Gene

Enhancers for CPD Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17F030350 1.1 Ensembl ENCODE 11.7 -27.3 -27326 2.9 SOX13 KLF1 SAP130 ZNF384 RAD21 ZBTB40 RARA ZNF7 ZNF664 EED CPD BLMH RNU6-1267P SLC6A4 GC17M030345 GC17P030362 ENSG00000207132
GH17F030362 1.5 FANTOM5 Ensembl ENCODE 8.3 -15.2 -15205 2.2 PKNOX1 BMI1 ZNF121 EGR1 SCRT2 ZNF143 FOS CREM EGR2 CBFB TEFM ATAD5 CPD BLMH LOC101927093 NSRP1 SSH2 GOSR1 GC17P030363
GH17F030476 1.1 ENCODE 10.9 +98.7 98665 2.0 HDGF PKNOX1 ARNT CREB3L1 WRNIP1 ZFP64 ARID4B SIN3A DMAP1 ZNF2 RNF135 ENSG00000264456 CORO6 CPD LRRC37BP1 BLMH RNU6-1267P GOSR1 LOC101927093 CRLF3
GH17F030343 1.7 FANTOM5 Ensembl ENCODE 5.8 -33.7 -33701 4.0 PKNOX1 ATF1 MLX ARID4B SIN3A DMAP1 ZNF48 YY1 SLC30A9 GATA2 BLMH RNU6-1267P TBC1D29 CPD EFCAB5 NSRP1 ENSG00000207132 GC17M030345 GC17P030362
GH17F030263 0.9 Ensembl ENCODE 10.4 -114.6 -114594 1.7 OVOL3 FEZF1 ZNF843 YY1 OSR2 ZNF664 ZNF121 ATF3 WT1 SP7 BLMH SLC6A4 RNU6-1267P MIR423 NSRP1 CPD TBC1D29 LRRC37BP1 CORO6 GC17M030249
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CPD on UCSC Golden Path with GeneCards custom track

Promoters for CPD Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001343840 895 3201 HDGF ARNT WRNIP1 ARID4B SIN3A FEZF1 ZNF2 YY1 ZNF207 FOS

Genomic Location for CPD Gene

Chromosome:
17
Start:
30,378,905 bp from pter
End:
30,469,989 bp from pter
Size:
91,085 bases
Orientation:
Plus strand

Genomic View for CPD Gene

Genes around CPD on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CPD Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CPD Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for CPD Gene

Proteins for CPD Gene

  • Protein details for CPD Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75976-CBPD_HUMAN
    Recommended name:
    Carboxypeptidase D
    Protein Accession:
    O75976
    Secondary Accessions:
    • B7Z7T9
    • B7ZAU4
    • F5GZH6
    • O15377
    • Q86SH9
    • Q86XE6

    Protein attributes for CPD Gene

    Size:
    1380 amino acids
    Molecular mass:
    152931 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for CPD Gene

    Alternative splice isoforms for CPD Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CPD Gene

Selected DME Specific Peptides for CPD Gene

O75976:
  • QTVENKETLKHLAS
  • GLENATI
  • LTACIIWC
  • DMEIFLRR
  • EYFPHGITNGA
  • GDYWRLL
  • FVLSANLHGG
  • WYDVEGGMQDYNYVWANCFEITLELSCCKYPP
  • YPFVLSANLHGGSLVVNYP
  • YSKSPDDAVFQQ
  • PETKAIIENLI
  • RELYVMEISDNPG
  • MPSMNPDGYEKSQEGD
  • NSRGRDLNRSFPDQF
  • YLLPSLNPDGFERAREGDCG
  • GEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVT
  • DLNRNFPD
  • MPSMNPDG
  • TNCFEVTIELGCVKYP
  • CFEITLELSC
  • EWHSHLGSMKD
  • ALSYSKEN
  • IWSLEISNKPN
  • INHPVTTYK
  • ELSCCKYP
  • GHCPEITVYTSCCYFPSA
  • YKDLSEFLRGL
  • GFVLDATDGRGILNAT
  • QEWENNRESL
  • GITNGAHWY
  • GNMHGNE
  • CSIKSNRHKDGF
  • LPGRPQVKLVGNMHGDE
  • LSGNLHGGSVVASYP
  • NYPHITNLT
  • NRIFGLPRELVVTV
  • SEPEEPKIRFVAGIHGNAPVGTELLLALAEFLC
  • PSMNPDGYE
  • WYNVPGGMQDWNYL

Post-translational modifications for CPD Gene

  • Glycosylation at Thr 40, Thr 41, Thr 42, Thr 43, Thr 44, Ser 45, Asn 172, Asn 217, Asn 399, Asn 410, Asn 429, Thr 489, Asn 522, Asn 626, Asn 811, Asn 855, Asn 867, Asn 879, Asn 955, Asn 978, Asn 1070, and Asn 1142
  • Modification sites at PhosphoSitePlus

Other Protein References for CPD Gene

Domains & Families for CPD Gene

Gene Families for CPD Gene

Suggested Antigen Peptide Sequences for CPD Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O75976

UniProtKB/Swiss-Prot:

CBPD_HUMAN :
  • There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
  • Belongs to the peptidase M14 family.
Domain:
  • There are 3 carboxypeptidase-like domains. Only the first two domains seem to have kept a catalytic activity.
Family:
  • Belongs to the peptidase M14 family.
genes like me logo Genes that share domains with CPD: view

Function for CPD Gene

Molecular function for CPD Gene

GENATLAS Biochemistry:
carboxypeptidase D,175-180kDa ,regulatory family,highly expressed in placenta,pancreas,hepatoma cells,most cell glycoprotein binding duck hepatitis B virus particles,involved in secretory pathway
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
pH dependence: Optimum pH is 6.0-6.5.;
UniProtKB/Swiss-Prot CatalyticActivity:
Releases C-terminal Arg and Lys from polypeptides.

Enzyme Numbers (IUBMB) for CPD Gene

Gene Ontology (GO) - Molecular Function for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004181 metallocarboxypeptidase activity IEA,IBA --
GO:0004185 serine-type carboxypeptidase activity IEA --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0008270 zinc ion binding IEA --
genes like me logo Genes that share ontologies with CPD: view
genes like me logo Genes that share phenotypes with CPD: view

Animal Model Products

  • Taconic Biosciences Mouse Models for CPD

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CPD Gene

Localization for CPD Gene

Subcellular locations from UniProtKB/Swiss-Prot for CPD Gene

Cell membrane; Single-pass type I membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CPD gene
Compartment Confidence
extracellular 5
plasma membrane 4
cytosol 2
golgi apparatus 2
peroxisome 1
endoplasmic reticulum 1
lysosome 1
endosome 1

Gene Ontology (GO) - Cellular Components for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005615 extracellular space IBA --
GO:0005634 nucleus IBA --
GO:0005802 trans-Golgi network IBA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA,IDA 19946888
genes like me logo Genes that share ontologies with CPD: view

Pathways & Interactions for CPD Gene

genes like me logo Genes that share pathways with CPD: view

Gene Ontology (GO) - Biological Process for CPD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0006518 peptide metabolic process IBA --
GO:0016485 protein processing IBA --
genes like me logo Genes that share ontologies with CPD: view

No data available for SIGNOR curated interactions for CPD Gene

Drugs & Compounds for CPD Gene

(28) Drugs for CPD Gene - From: DrugBank, ClinicalTrials, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Dexamethasone Approved, Investigational, Vet_approved Pharma Agonist 2084
Pomalidomide Approved Pharma 123
Thalidomide Approved, Investigational, Withdrawn Pharma Immunomodulatory agent,sedative drug,angiogenesis inhibitor, Immunomodulatory agents, TNF-alpha synthesis inhibitor 1105
Zinc Approved Pharma 2231
Guanidinoethylmercaptosuccinic acid Experimental Pharma Target 0

(2) Additional Compounds for CPD Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
D-Mannose
  • (+)-mannose
  • (+-)-mannose
  • Carubinose
  • D(+)-Mannose
  • D-Mannopyranose
3458-28-4
genes like me logo Genes that share compounds with CPD: view

Transcripts for CPD Gene

Unigene Clusters for CPD Gene

Carboxypeptidase D:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for CPD Gene

No ASD Table

Relevant External Links for CPD Gene

GeneLoc Exon Structure for
CPD
ECgene alternative splicing isoforms for
CPD

Expression for CPD Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for CPD Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for CPD Gene

This gene is overexpressed in Whole Blood (x5.9).

Protein differential expression in normal tissues from HIPED for CPD Gene

This gene is overexpressed in Salivary gland (21.6) and Oral epithelium (8.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CPD Gene



Protein tissue co-expression partners for CPD Gene

NURSA nuclear receptor signaling pathways regulating expression of CPD Gene:

CPD

SOURCE GeneReport for Unigene cluster for CPD Gene:

Hs.446079

mRNA Expression by UniProt/SwissProt for CPD Gene:

O75976-CBPD_HUMAN
Tissue specificity: Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.
genes like me logo Genes that share expression patterns with CPD: view

Orthologs for CPD Gene

This gene was present in the common ancestor of animals.

Orthologs for CPD Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia CPD 34 35
  • 99.71 (n)
dog
(Canis familiaris)
Mammalia CPD 34 35
  • 92.52 (n)
cow
(Bos Taurus)
Mammalia CPD 35
  • 92 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Cpd 34 16 35
  • 88.26 (n)
rat
(Rattus norvegicus)
Mammalia Cpd 34
  • 87.83 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia CPD 35
  • 87 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia CPD 35
  • 81 (a)
OneToOne
chicken
(Gallus gallus)
Aves CPD 34 35
  • 75.04 (n)
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 34 (a)
ManyToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC101730225 34
  • 69.58 (n)
zebrafish
(Danio rerio)
Actinopterygii cpda 34 35
  • 62.68 (n)
cpdb 35
  • 46 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta svr 36 34 35
  • 48.74 (n)
CG4678 36
  • 44 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP002414 34
  • 47.32 (n)
worm
(Caenorhabditis elegans)
Secernentea cpd-2 34 35
  • 53.75 (n)
F59A3.1 36
  • 49 (a)
T27A8.1 36
  • 45 (a)
F01D4.4 36
  • 42 (a)
cpd-1 35
  • 28 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 56 (a)
OneToOne
Species where no ortholog for CPD was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CPD Gene

ENSEMBL:
Gene Tree for CPD (if available)
TreeFam:
Gene Tree for CPD (if available)

Paralogs for CPD Gene

Paralogs for CPD Gene

(3) SIMAP similar genes for CPD Gene using alignment to 4 proteins:

Pseudogenes.org Pseudogenes for CPD Gene

genes like me logo Genes that share paralogs with CPD: view

Variants for CPD Gene

Sequence variations from dbSNP and Humsavar for CPD Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1043140 -- 30,449,657(+) TGGTA(C/T)CCATG reference, missense
rs10491108 -- 30,466,299(+) ATTAA(C/T)GTATC utr-variant-3-prime
rs1057993 -- 30,444,079(+) TGAAT(A/G)GATTG intron-variant
rs11080125 -- 30,386,708(+) CAATA(G/T)TCTTC intron-variant
rs11080126 -- 30,397,499(+) aggcc(A/G)atgca intron-variant

Structural Variations from Database of Genomic Variants (DGV) for CPD Gene

Variant ID Type Subtype PubMed ID
esv2673490 CNV deletion 23128226
esv3554304 CNV deletion 23714750
nsv1064611 CNV gain 25217958
nsv515870 CNV gain 19592680

Variation tolerance for CPD Gene

Residual Variation Intolerance Score: 13.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.27; 62.55% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CPD Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
CPD

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CPD Gene

Disorders for CPD Gene

MalaCards: The human disease database

(1) MalaCards diseases for CPD Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
hepatitis b
  • chronic hepatitis b
- elite association - COSMIC cancer census association via MalaCards
Search CPD in MalaCards View complete list of genes associated with diseases

Relevant External Links for CPD

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CPD
genes like me logo Genes that share disorders with CPD: view

No data available for UniProtKB/Swiss-Prot and Genatlas for CPD Gene

Publications for CPD Gene

  1. Sequence of human carboxypeptidase D reveals it to be a member of the regulatory carboxypeptidase family with three tandem active site domains. (PMID: 9355738) Tan F. … Skidgel R.A. (Biochem. J. 1997) 2 3 4 22 64
  2. Palmitoylation of carboxypeptidase D. Implications for intracellular trafficking. (PMID: 12643288) Kalinina E.V. … Fricker L.D. (J. Biol. Chem. 2003) 3 4 22 64
  3. Chromosomal localization of the genes for human carboxypeptidase D (CPD) and the active 50-kilodalton subunit of human carboxypeptidase N (CPN1). (PMID: 9628828) Riley D.A. … Skidgel R.A. (Genomics 1998) 2 3 22 64
  4. Cloning, functional expression, and chromosomal localization of the human and mouse gp180-carboxypeptidase D-like enzyme. (PMID: 9714835) Ishikawa T. … Kuroki K. (Gene 1998) 3 4 22 64
  5. Identification of a membrane-bound carboxypeptidase as the mammalian homolog of duck gp180, a hepatitis B virus-binding protein. (PMID: 9064476) McGwire G.B. … Skidgel R.A. (Life Sci. 1997) 3 4 22 64

Products for CPD Gene

Sources for CPD Gene

Content
Loading form....