Aliases for CHST10 Gene
Aliases for CHST10 Gene
External Ids for CHST10 Gene
- HGNC: 19650
- Entrez Gene: 9486
- Ensembl: ENSG00000115526
- OMIM: 606376
- UniProtKB: O43529
Previous GeneCards Identifiers for CHST10 Gene
- GC02M099461
- GC02M100612
- GC02M100629
- GC02M101008
- GC02M094773
Summaries for CHST10 Gene
-
This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.[provided by RefSeq, Feb 2011]
GeneCards Summary for CHST10 Gene
CHST10 (Carbohydrate Sulfotransferase 10) is a Protein Coding gene. Diseases associated with CHST10 include Retinitis Pigmentosa 33. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include sulfotransferase activity and HNK-1 sulfotransferase activity. An important paralog of this gene is CHST9.
UniProtKB/Swiss-Prot for CHST10 Gene
-
Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
Additional gene information for CHST10 Gene
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CHST10 Gene
Genomics for CHST10 Gene
GeneHancer (GH) Regulatory Elements for CHST10 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH02I100416 | Promoter/Enhancer | 1.9 | EPDnew Ensembl ENCODE | 560.8 | +0.2 | 244 | 1.6 | ZFP64 SIN3A DMAP1 ZNF2 ZNF48 ZNF143 ATF7 SP3 ZNF592 KAT8 | CHST10 REV1 ENSG00000270699 | |
GH02I100418 | Enhancer | 0.3 | ENCODE | 550.8 | -1.1 | -1066 | 0.2 | SAP130 | CHST10 LOC129522 | |
GH02I100588 | Enhancer | 1.4 | FANTOM5 Ensembl ENCODE | 10.3 | -170.6 | -170633 | 0.6 | ATF1 IRF4 ZNF766 ATF7 FOS RUNX3 JUNB TSHZ1 ZNF518A NFIL3 | PDCL3 CHST10 RPL31 HMGN2P22 | |
GH02I100320 | Promoter/Enhancer | 2.2 | EPDnew FANTOM5 Ensembl ENCODE | 6.1 | +96.0 | 96037 | 2.7 | RB1 SIN3A BMI1 ZNF2 ZNF335 GLIS2 EGR1 SCRT2 EGR2 CEBPB | LONRF2 CHST10 LINC01104 | |
GH02I100393 | Enhancer | 1 | FANTOM5 ENCODE | 11.8 | +22.7 | 22722 | 2.1 | HDGF PKNOX1 SMAD1 PAX8 EBF1 IRF4 E4F1 RELA POLR2A ZNF143 | AFF3 CHST10 LONRF2 ENSG00000270699 |
Regulatory Element Products
Genomic Locations for CHST10 Gene
- chr2:100,391,860-100,417,668
- (GRCh38/hg38)
- Size:
- 25,809 bases
- Orientation:
- Minus strand
- chr2:101,008,322-101,034,130
- (GRCh37/hg19)
Genomic View for CHST10 Gene
- Cytogenetic band:
-
- 2q11.2 by Ensembl
- 2q11.2 by Entrez Gene
- 2q11.2 by HGNC


RefSeq DNA sequence for CHST10 Gene
Proteins for CHST10 Gene
-
Protein details for CHST10 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O43529-CHSTA_HUMAN
- Recommended name:
- Carbohydrate sulfotransferase 10
- Protein Accession:
- O43529
- Q53T18
Protein attributes for CHST10 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 42207 Da
- Quaternary structure:
- No Data Available
Protein Expression for CHST10 Gene
Selected DME Specific Peptides for CHST10 Gene
- O43529:
-
- KFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNG
- DFKLFGY
- NGLPRLSS
- GHHETLE
- NPRFEPWY
- YNRTKVE
- QFGDHIIHW
- LCAPCEI
- YFKFFIVRDPFERLISAFKDKFV
Post-translational modifications for CHST10 Gene
- Glycosylation at posLast=6666, posLast=9999, posLast=228228, and Asn316
Other Protein References for CHST10 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for CHST10
- Novus Biologicals Antibodies for CHST10
- Invitrogen Antibodies for CHST10
- Search GeneTex for Antibodies for CHST10
Protein Products
- R&D Systems Proteins and Enzymes for CHST10 (Carbohydrate Sulfotransferase 10/CHST10)
-
OriGene Purified Proteins for CHST10
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- ProSpec Recombinant Proteins for CHST10
- Search GeneTex for Proteins for CHST10
-
Abcam proteins for CHST10
Assay Products
Domains & Families for CHST10 Gene
Gene Families for CHST10 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Predicted intracellular proteins
- Predicted membrane proteins
- Predicted secreted proteins
Protein Domains for CHST10 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for CHST10 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
O43529- Family:
-
- Belongs to the sulfotransferase 2 family.
Function for CHST10 Gene
Molecular function for CHST10 Gene
- UniProtKB/Swiss-Prot Function:
- Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
Enzyme Numbers (IUBMB) for CHST10 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0008146 | sulfotransferase activity | IEA,TAS | 9478973 |
GO:0016232 | HNK-1 sulfotransferase activity | TAS | -- |
GO:0016740 | transferase activity | IEA | -- |
Phenotypes for CHST10 Gene
- MGI mutant phenotypes for CHST10:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for CHST10:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for CHST10
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
- Search ViGene Biosciences for CHST10
CRISPR Products
-
OriGene CRISPR knockouts for CHST10
- genomics-online: gRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- Applied Biological Materials CRISPR for CHST10
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
miRNA for CHST10 Gene
- miRTarBase miRNAs that target CHST10
miRNA Products
- Search ViGene Biosciences for CHST10
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- genomics-online: shRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
Clone Products
- Sino Biological Human cDNA Clone for CHST10
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for CHST10
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for CHST10
-
ViGene Biosciences adenoviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CHST10 Gene
Localization for CHST10 Gene
Subcellular locations from UniProtKB/Swiss-Prot for CHST10 Gene
- Golgi apparatus membrane; Single-pass type II membrane protein.
- Cytosol (2)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000139 | Golgi membrane | TAS | -- |
GO:0005794 | Golgi apparatus | TAS,IEA | 9478973 |
GO:0016020 | membrane | TAS,IEA | 9478973 |
GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for CHST10 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Transport to the Golgi and subsequent modification | ||
2 | Metabolism of proteins | ||
3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
4 | Mannose type O-glycan biosynthesis | ||
5 | Metabolism |
Pathways by source for CHST10 Gene
1 BioSystems pathway for CHST10 Gene
2 KEGG pathways for CHST10 Gene
1 R&D Systems pathway for CHST10 Gene
Interacting Proteins for CHST10 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005975 | carbohydrate metabolic process | IEA | -- |
GO:0007155 | cell adhesion | TAS | 9478973 |
GO:0016051 | carbohydrate biosynthetic process | IEA | -- |
No data available for SIGNOR curated interactions for CHST10 Gene
Transcripts for CHST10 Gene
mRNA/cDNA for CHST10 Gene
- (10) REFSEQ mRNAs :
- (5) Additional mRNA sequences :
- (154) Selected AceView cDNA sequences:
- (12) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for CHST10 Gene
CRISPR Products
-
OriGene CRISPR knockouts for CHST10
- genomics-online: gRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- Applied Biological Materials CRISPR for CHST10
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
miRNA Products
- Search ViGene Biosciences for CHST10
Inhibitory RNA Products
- Origene shrna and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- genomics-online: shRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
Clone Products
- Sino Biological Human cDNA Clone for CHST10
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for CHST10
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | · | 1f | ^ | 2a | · | 2b | · | 2c | ^ | 3a | · | 3b | · | 3c | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12a | · | 12b | · | 12c | · |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
SP2: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
SP3: | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||
SP4: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
SP5: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP6: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||
SP7: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
SP8: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP10: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
SP11: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
SP12: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
SP13: |
ExUns: | 12d | ^ | 13a | · | 13b | ^ | 14a | · | 14b |
---|---|---|---|---|---|---|---|---|---|
SP1: | - | ||||||||
SP2: | |||||||||
SP3: | |||||||||
SP4: | |||||||||
SP5: | |||||||||
SP6: | |||||||||
SP7: | |||||||||
SP8: | |||||||||
SP9: | |||||||||
SP10: | |||||||||
SP11: | |||||||||
SP12: | |||||||||
SP13: |
Expression for CHST10 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for CHST10 Gene
NURSA nuclear receptor signaling pathways regulating expression of CHST10 Gene:
CHST10SOURCE GeneReport for Unigene cluster for CHST10 Gene:
Hs.516370mRNA Expression by UniProt/SwissProt for CHST10 Gene:
O43529-CHSTA_HUMANEvidence on tissue expression from TISSUES for CHST10 Gene
- Nervous system(4.7)
Primer Products
-
OriGene qPCR primer pairs and template standards for CHST10
-
OriGene qPCR primer pairs for CHST10
- genomics-online: primer clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CHST10 Gene
Orthologs for CHST10 Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | CHST10 34 33 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | -- 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
dog (Canis familiaris) |
Mammalia | CHST10 34 33 |
|
OneToOne | |
rat (Rattus norvegicus) |
Mammalia | Chst10 33 |
|
||
mouse (Mus musculus) |
Mammalia | Chst10 16 34 33 |
|
||
cow (Bos Taurus) |
Mammalia | CHST10 34 33 |
|
OneToOne | |
oppossum (Monodelphis domestica) |
Mammalia | CHST10 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | CHST10 34 33 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | CHST10 34 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | chst10 33 |
|
||
Str.16232 33 |
|
||||
African clawed frog (Xenopus laevis) |
Amphibia | Xl.8239 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | chst10 34 33 |
|
OneToOne | |
Dr.11834 33 |
|
||||
fruit fly (Drosophila melanogaster) |
Insecta | CG14024 34 |
|
ManyToMany | |
CG13937 34 |
|
ManyToMany | |||
sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
ManyToMany | |
-- 34 |
|
ManyToMany | |||
-- 34 |
|
ManyToMany | |||
-- 34 |
|
ManyToMany | |||
-- 34 |
|
ManyToMany |
- Species where no ortholog for CHST10 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for CHST10 Gene
(4) SIMAP similar genes for CHST10 Gene using alignment to 8 proteins:
Variants for CHST10 Gene
SNP ID | Clin | Chr 02 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000094707 | -- | 100,396,604(-) | T/C | intron_variant | |
rs1000112120 | -- | 100,416,722(-) | C/T | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant | |
rs1000295073 | -- | 100,416,452(-) | A/G | 5_prime_UTR_variant, intron_variant | |
rs1000319208 | -- | 100,399,196(-) | C/T | intron_variant | |
rs1000441620 | -- | 100,417,034(-) | C/T | genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant |
Additional Variant Information for CHST10 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- CHST10
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CHST10 Gene
Disorders for CHST10 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
retinitis pigmentosa 33 |
|
|
Additional Disease Information for CHST10
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for CHST10 Gene
Publications for CHST10 Gene
- Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases. (PMID: 12080076) Kang HG … Schachner M (The Journal of biological chemistry 2002) 2 3 22 58
- Structure and function of HNK-1 sulfotransferase. Identification of donor and acceptor binding sites by site-directed mutagenesis. (PMID: 10464296) Ong E … Fukuda M (The Journal of biological chemistry 1999) 3 4 22 58
- Expression cloning of a human sulfotransferase that directs the synthesis of the HNK-1 glycan on the neural cell adhesion molecule and glycolipids. (PMID: 9478973) Ong E … Fukuda M (The Journal of biological chemistry 1998) 3 4 22 58
- Mechanism of regulation and suppression of melanoma invasiveness by novel retinoic acid receptor-gamma target gene carbohydrate sulfotransferase 10. (PMID: 19470764) Zhao X … Spanjaard RA (Cancer research 2009) 3 22 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
Products for CHST10 Gene
- Browse R&D Systems for Antibodies
- R&D Systems Proteins and Enzymes for CHST10 (Carbohydrate Sulfotransferase 10/CHST10)
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CHST10
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for CHST10
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- Origene shrna and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- OriGene qPCR primer pairs and template standards for CHST10
- OriGene qPCR primer pairs for CHST10
- OriGene CRISPR knockouts for CHST10
- OriGene ORF clones in human for CHST10
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CHST10
- GenScript: Next-day shipping of latest version cDNA ORF clones for CHST10 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CHST10
- GenScript Custom Assay Services for CHST10
- GenScript Custom overexpressing Cell Line Services for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CHST10
- Sino Biological Human cDNA Clone for CHST10
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for CHST10
- Novus Biologicals proteins and lysates for CHST10
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam proteins for CHST10
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for CHST10
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for CHST10
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for CHST10
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 42 available CHST10 Antibodies ranked by validation data
- Compare Top CHST10 Antibodies
- antibodies-online: Search results for available CHST10 related products ranked by validation data
- antibodies-online: Search results for 11 available CHST10 Proteins ranked by validation data
- Compare Top CHST10 Proteins
- Quality Products:
- Search GeneTex for Antibodies for CHST10
- Search GeneTex for Proteins for CHST10
- ViGene Biosciences adenoviral particle packaged cDNA for CHST10 gene
- ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
- ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
- Search ViGene Biosciences for CHST10
- Horizon Cell Lines for CHST10
- genomics-online: cdna clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- orf clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- genomics-online: gRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- genomics-online: primer clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
- genomics-online: shRNA clones - Search results for 106 available CHST10 gene related products
- Overview of 106 available CHST10 gene related products
Sources for CHST10 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew