Aliases for CHST10 Gene
Aliases for CHST10 Gene
External Ids for CHST10 Gene
- HGNC: 19650
- Entrez Gene: 9486
- Ensembl: ENSG00000115526
- OMIM: 606376
- UniProtKB: O43529
Previous GeneCards Identifiers for CHST10 Gene
- GC02M099461
- GC02M100612
- GC02M100629
- GC02M101008
- GC02M094773
Summaries for CHST10 Gene
-
This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.[provided by RefSeq, Feb 2011]
GeneCards Summary for CHST10 Gene
CHST10 (Carbohydrate Sulfotransferase 10) is a Protein Coding gene. Diseases associated with CHST10 include Retinitis Pigmentosa 33. Among its related pathways are Mannose type O-glycan biosynthesis and N-glycan antennae elongation in the medial/trans-Golgi. GO annotations related to this gene include sulfotransferase activity and HNK-1 sulfotransferase activity. An important paralog of this gene is CHST8.
UniProtKB/Swiss-Prot for CHST10 Gene
-
Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CHST10 Gene
Genomics for CHST10 Gene
Regulatory Elements for CHST10 Gene
Enhancers for CHST10 Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH02G100393 | 1.2 | FANTOM5 ENCODE | 11.8 | +22.7 | 22723 | 2.1 | HDGF PKNOX1 BMI1 ZBTB40 CBX5 ZNF143 RELB IKZF2 CREM PAF1 | AFF3 CHST10 LONRF2 ENSG00000270699 |
| GH02G100416 | 1 | ENCODE | 10.7 | +0.2 | 231 | 1.6 | CREB3L1 ZFP64 SIN3A DMAP1 ZNF2 ZNF48 ELK1 ZNF143 PAF1 SP3 | CHST10 ENSG00000270699 |
| GH02G099984 | 0.7 | ENCODE | 12.8 | +432.8 | 432771 | 1.3 | ZFP64 ZNF426 FEZF1 ZNF394 ZNF781 ZNF518A ZNF697 OSR2 PRDM6 ZNF555 | LOC550644 REV1 CHST10 LONRF2 ENSG00000230393 GC02P099881 |
| GH02G100287 | 1.9 | FANTOM5 Ensembl ENCODE dbSUPER | 4.6 | +126.6 | 126554 | 7.1 | HDGF PKNOX1 CREB3L1 ARNT SIN3A FEZF1 ZNF766 CBX5 FOS ZNF263 | REV1 LONRF2 ENSG00000273306 CHST10 LINC01104 |
| GH02G100320 | 1.3 | FANTOM5 ENCODE | 6.1 | +96.0 | 96038 | 2.7 | RB1 SIN3A BMI1 ZNF2 GLIS2 EGR1 SCRT2 PCBP1 EGR2 CEBPB | LONRF2 CHST10 LINC01104 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around CHST10 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for CHST10 Gene
- Chromosome:
- 2
- Start:
- 100,391,860 bp from pter
- End:
- 100,417,668 bp from pter
- Size:
- 25,809 bases
- Orientation:
- Minus strand
Genomic View for CHST10 Gene
Genes around CHST10 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2q11.2 by Ensembl
- 2q11.2 by Entrez Gene
- 2q11.2 by HGNC
CHST10 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CHST10 Gene
Proteins for CHST10 Gene
-
Protein details for CHST10 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O43529-CHSTA_HUMAN
- Recommended name:
- Carbohydrate sulfotransferase 10
- Protein Accession:
- O43529
- Q53T18
Protein attributes for CHST10 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 42207 Da
- Quaternary structure:
- No Data Available
Protein Expression for CHST10 Gene
Selected DME Specific Peptides for CHST10 Gene
- O43529:
-
- KFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNG
- DFKLFGY
- NGLPRLSS
- GHHETLE
- NPRFEPWY
- YNRTKVE
- QFGDHIIHW
- LCAPCEI
- YFKFFIVRDPFERLISAFKDKFV
Post-translational modifications for CHST10 Gene
Other Protein References for CHST10 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for CHST10
- Novus Biologicals Antibodies for CHST10
-
Abcam antibodies for CHST10
- Invitrogen Antibodies for CHST10
- antibodies-online Antibodies for CHST10: See all 34
- GeneTex CHST10 antibody for CHST10
Protein Products
- R&D Systems Proteins and Enzymes for CHST10 (Carbohydrate Sulfotransferase 10/CHST10)
-
OriGene Purified Proteins for CHST10
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- ProSpec Recombinant Proteins for CHST10
- antibodies-online Proteins for CHST10: See all 8
- Search antibodies-online for peptides
- Search GeneTex for Proteins for CHST10
-
Abcam proteins for CHST10
Assay Products
- antibodies-online Kits for CHST10: See all 3
Domains & Families for CHST10 Gene
Gene Families for CHST10 Gene
Protein Domains for CHST10 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for CHST10 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
O43529- Family:
-
- Belongs to the sulfotransferase 2 family.
Function for CHST10 Gene
Molecular function for CHST10 Gene
- UniProtKB/Swiss-Prot Function:
- Catalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. May be indirectly involved in synapse plasticity of the hippocampus, via its role in HNK-1 biosynthesis.
Enzyme Numbers (IUBMB) for CHST10 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0008146 | sulfotransferase activity | IEA,TAS | 9478973 |
| GO:0016232 | HNK-1 sulfotransferase activity | TAS | -- |
| GO:0016740 | transferase activity | IEA | -- |
Phenotypes for CHST10 Gene
- MGI mutant phenotypes for CHST10:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for CHST10:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for CHST10
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
- Search ViGene Biosciences for CHST10
CRISPR Products
-
OriGene CRISPR knockouts for CHST10
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
miRNA for CHST10 Gene
- miRTarBase miRNAs that target CHST10
miRNA Products
- Search ViGene Biosciences for CHST10
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
Clone Products
-
OriGene ORF clones in human for CHST10
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for CHST10
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for CHST10
-
ViGene Biosciences adenoviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CHST10 Gene
Localization for CHST10 Gene
Subcellular locations from UniProtKB/Swiss-Prot for CHST10 Gene
- Golgi apparatus membrane; Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| extracellular | 3 |
| cytosol | 2 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005794 | Golgi apparatus | TAS | 9478973 |
| GO:0016020 | membrane | IEA,TAS | 9478973 |
| GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for CHST10 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Transport to the Golgi and subsequent modification | ||
| 2 | Metabolism of proteins | ||
| 3 | N-glycan antennae elongation in the medial/trans-Golgi | ||
| 4 | Mannose type O-glycan biosynthesis | ||
| 5 | Metabolism | ||
Pathways by source for CHST10 Gene
1 BioSystems pathway for CHST10 Gene
2 KEGG pathways for CHST10 Gene
1 R&D Systems pathway for CHST10 Gene
Interacting Proteins for CHST10 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | IEA | -- |
| GO:0007155 | cell adhesion | TAS | 9478973 |
| GO:0016051 | carbohydrate biosynthetic process | IEA | -- |
No data available for SIGNOR curated interactions for CHST10 Gene
Transcripts for CHST10 Gene
mRNA/cDNA for CHST10 Gene
- (10) REFSEQ mRNAs :
- (5) Additional mRNA sequences :
- (154) Selected AceView cDNA sequences:
- (12) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for CHST10 Gene
CRISPR Products
-
OriGene CRISPR knockouts for CHST10
-
Santa Cruz Biotechnology (SCBT) CRISPR for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
miRNA Products
- Search ViGene Biosciences for CHST10
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
-
ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
Clone Products
-
OriGene ORF clones in human for CHST10
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for CHST10
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | · | 1f | ^ | 2a | · | 2b | · | 2c | ^ | 3a | · | 3b | · | 3c | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11 | ^ | 12a | · | 12b | · | 12c | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP11: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: |
| ExUns: | 12d | ^ | 13a | · | 13b | ^ | 14a | · | 14b |
|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||
| SP2: | |||||||||
| SP3: | |||||||||
| SP4: | |||||||||
| SP5: | |||||||||
| SP6: | |||||||||
| SP7: | |||||||||
| SP8: | |||||||||
| SP9: | |||||||||
| SP10: | |||||||||
| SP11: | |||||||||
| SP12: | |||||||||
| SP13: |
Expression for CHST10 Gene
This gene is overexpressed in Vitreous humor (67.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for CHST10 Gene
NURSA nuclear receptor signaling pathways regulating expression of CHST10 Gene:
CHST10SOURCE GeneReport for Unigene cluster for CHST10 Gene:
Hs.516370mRNA Expression by UniProt/SwissProt for CHST10 Gene:
O43529-CHSTA_HUMAN
Tissue specificity:
In fetal tissues, it is predominantly expressed in brain, and weakly expressed in lung, kidney and liver. In adult, it is highly expressed in brain, testis, ovary, expressed at intermediate level in heart, pancreas, skeletal muscle, spleen and thymus, and weakly expressed in other tissues. In brain, it is expressed at higher level in the frontal lobe.
Evidence on tissue expression from TISSUES for CHST10 Gene
- Nervous system(4.7)
Primer Products
-
OriGene qPCR primer pairs and template standards for CHST10
-
OriGene qPCR primer pairs for CHST10
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CHST10 Gene
Orthologs for CHST10 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | CHST10 34 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 35 |
|
OneToMany | |
| -- 35 |
|
OneToMany | |||
| dog (Canis familiaris) |
Mammalia | CHST10 34 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Chst10 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Chst10 34 16 35 |
|
||
| cow (Bos Taurus) |
Mammalia | CHST10 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | CHST10 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | CHST10 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | CHST10 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | chst10 34 |
|
||
| Str.16232 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.8239 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | chst10 34 35 |
|
||
| Dr.11834 34 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | CG14024 35 |
|
ManyToMany | |
| CG13937 35 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
ManyToMany | |
| -- 35 |
|
ManyToMany | |||
| -- 35 |
|
ManyToMany | |||
| -- 35 |
|
ManyToMany | |||
| -- 35 |
|
ManyToMany |
- Species where no ortholog for CHST10 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for CHST10 Gene
(4) SIMAP similar genes for CHST10 Gene using alignment to 8 proteins:
Variants for CHST10 Gene
| SNP ID | Clin | Chr 02 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000094707 | -- | 100,396,604(+) | TGCTA(C/T)GGATG | intron-variant | |
| rs1000112120 | -- | 100,416,722(+) | ACCCA(C/T)CGTTA | intron-variant, upstream-variant-2KB | |
| rs1000295073 | -- | 100,416,452(+) | GACTA(A/G)GCTCT | intron-variant, utr-variant-5-prime | |
| rs1000319208 | -- | 100,399,196(+) | CCTCC(C/T)GGGTT | intron-variant | |
| rs1000441620 | -- | 100,417,034(+) | TGCTC(C/T)TTGGA | intron-variant, upstream-variant-2KB |
Residual Variation Intolerance Score:
73.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
8.49;
85.84% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for CHST10 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- CHST10
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CHST10 Gene
Disorders for CHST10 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| retinitis pigmentosa 33 |
|
|
Search CHST10 in MalaCards
View complete list of genes associated with diseases
Relevant External Links for CHST10
No data available for UniProtKB/Swiss-Prot and Genatlas for CHST10 Gene
Publications for CHST10 Gene
- Molecular cloning and characterization of chondroitin-4-O- sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases. (PMID: 12080076) Kang H.-G. … Schachner M. (J. Biol. Chem. 2002) 2 3 22 64
- Structure and function of HNK-1 sulfotransferase. Identification of donor and acceptor binding sites by site-directed mutagenesis. (PMID: 10464296) Ong E. … Fukuda M. (J. Biol. Chem. 1999) 3 4 22 64
- Expression cloning of a human sulfotransferase that directs the synthesis of the HNK-1 glycan on the neural cell adhesion molecule and glycolipids. (PMID: 9478973) Ong E. … Fukuda M. (J. Biol. Chem. 1998) 3 4 22 64
- Mechanism of regulation and suppression of melanoma invasiveness by novel retinoic acid receptor-gamma target gene carbohydrate sulfotransferase 10. (PMID: 19470764) Zhao X. … Spanjaard R.A. (Cancer Res. 2009) 3 22 64
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
Products for CHST10 Gene
- Browse R&D Systems for Antibodies
- R&D Systems Proteins and Enzymes for CHST10 (Carbohydrate Sulfotransferase 10/CHST10)
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CHST10
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for CHST10
- Search Origene for MassSpec and Protein Over-expression Lysates for CHST10
- Origene Custom Protein Services for CHST10
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CHST10
- Browse OriGene Inhibitory RNA Products For CHST10
- OriGene qPCR primer pairs and template standards for CHST10
- OriGene qPCR primer pairs for CHST10
- OriGene CRISPR knockouts for CHST10
- OriGene ORF clones in human for CHST10
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CHST10
- GenScript: Next-day shipping cDNA ORF clone for CHST10 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CHST10
- GenScript Custom Assay Services for CHST10
- GenScript Custom overexpressing Cell Line Services for CHST10
- GenScript: Design CRISPR guide RNA sequences for CHST10
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CHST10
- Sino Biological Human cDNA Clone for CHST10
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for CHST10
- Novus Biologicals proteins and lysates for CHST10
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for CHST10
- Abcam proteins for CHST10
- Search for Assays for CHST10 at Abcam
- Find your target
- Search knockout validated antibodies
- Browse monoclonal antibodies
- ProSpec Recombinant Proteins for CHST10
- antibodies-online Antibodies for CHST10: See all 34
- antibodies-online Kits for CHST10: See all 3
- antibodies-online Proteins for CHST10: See all 8
- Search antibodies-online for peptides
- GeneTex CHST10 antibody for CHST10
- Search GeneTex for Proteins for CHST10
- ViGene Biosciences adenoviral particle packaged cDNA for CHST10 gene
- ViGene Biosciences lentiviral particle packaged cDNA for CHST10 gene
- ViGene Biosciences ready-to-package AAV shRNAs for CHST10 gene
- Search ViGene Biosciences for CHST10
- Horizon Cell Lines for CHST10
- Cyagen custom Knockout/knockin (KOKI) mouse models for CHST10
- VectorBuilder custom plasmid, inducible vectors for CHST10
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CHST10
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for CHST10 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer