Aliases for CFTR Gene
Aliases for CFTR Gene
- Cystic Fibrosis Transmembrane Conductance Regulator 2 3 5
- Channel Conductance-Controlling ATPase 3 4
- CAMP-Dependent Chloride Channel 3 4
- EC 3.6.3.49 4 61
- ABCC7 3 4
- Cystic Fibrosis Transmembrane Conductance Regulator, ATP-Binding Cassette (Sub-Family C, Member 7) 2
- Cystic Fibrosis Transmembrane Conductance Regulator (ATP-Binding Cassette Sub-Family C, Member 7) 3
- ATP-Binding Cassette Sub-Family C, Member 7 2
- ATP-Binding Cassette Sub-Family C Member 7 4
External Ids for CFTR Gene
- HGNC: 1884
- Entrez Gene: 1080
- Ensembl: ENSG00000001626
- OMIM: 602421
- UniProtKB: P13569
Previous HGNC Symbols for CFTR Gene
- CF
- ABCC7
Previous GeneCards Identifiers for CFTR Gene
- GC07P115597
- GC07P116660
- GC07P116674
- GC07P116713
- GC07P116907
- GC07P117119
- GC07P111485
Summaries for CFTR Gene
-
This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily that is involved in multi-drug resistance. The encoded protein functions as a chloride channel and controls the regulation of other transport pathways. Mutations in this gene are associated with the autosomal recessive disorders cystic fibrosis and congenital bilateral aplasia of the vas deferens. Alternatively spliced transcript variants have been described, many of which result from mutations in this gene. [provided by RefSeq, Jul 2008]
GeneCards Summary for CFTR Gene
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) is a Protein Coding gene. Diseases associated with CFTR include Cystic Fibrosis and Congenital Bilateral Absence Of Vas Deferens. Among its related pathways are Bacterial infections in CF airways and Paroxetine Pathway, Pharmacokinetics. GO annotations related to this gene include enzyme binding and PDZ domain binding. An important paralog of this gene is ABCC4.
UniProtKB/Swiss-Prot for CFTR Gene
-
Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis (PubMed:26823428). Mediates the transport of chloride ions across the cell membrane (PubMed:10792060, PubMed:11524016, PubMed:11707463, PubMed:12519745, PubMed:15010471, PubMed:12588899, PubMed:17036051, PubMed:19398555, PubMed:19621064, PubMed:22178883, PubMed:25330774, PubMed:1712898, PubMed:8910473, PubMed:9804160, PubMed:12529365, PubMed:17182731, PubMed:26846474, PubMed:28087700). Channel activity is coupled to ATP hydrolysis (PubMed:8910473). The ion channel is also permeable to HCO(3-); selectivity depends on the extracellular chloride concentration (PubMed:15010471, PubMed:19019741). Exerts its function also by modulating the activity of other ion channels and transporters (PubMed:12403779, PubMed:22178883, PubMed:22121115, PubMed:27941075). Plays an important role in airway fluid homeostasis (PubMed:16645176, PubMed:19621064, PubMed:26823428). Contributes to the regulation of the pH and the ion content of the airway surface fluid layer and thereby plays an important role in defense against pathogens (PubMed:14668433, PubMed:16645176, PubMed:26823428). Modulates the activity of the epithelial sodium channel (ENaC) complex, in part by regulating the cell surface expression of the ENaC complex (PubMed:17434346, PubMed:27941075, PubMed:17182731). Inhibits the activity of the ENaC channel containing subunits SCNN1A, SCNN1B and SCNN1G (PubMed:17182731). Inhibits the activity of the ENaC channel containing subunits SCNN1D, SCNN1B and SCNN1G, but not of the ENaC channel containing subunits SCNN1A, SCNN1B and SCNN1G (PubMed:27941075). May regulate bicarbonate secretion and salvage in epithelial cells by regulating the transporter SLC4A7 (PubMed:12403779). Can inhibit the chloride channel activity of ANO1 (PubMed:22178883). Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation (PubMed:19923167, PubMed:27714810).
-
Chloride channels are a family of anion-selective channels involved in the regulation of the excitability of neurons, skeletal, cardiac and smooth muscle, cell volume regulation, transepithelial salt transport and the acidification of intra- and extracellular compartments.
No data available for CIViC summary , fRNAdb sequence ontologies and piRNA Summary for CFTR Gene
Genomics for CFTR Gene
Regulatory Elements for CFTR Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH07G118152 | 1 | ENCODE | 10 | +686.7 | 686653 | 0.8 | HDGF HNRNPUL1 ATF1 PKNOX1 ARNT TCF12 ZNF766 GATA2 ELK1 CBX5 | CFTR LSM8 PIR57573 ENSG00000234826 |
| GH07G117494 | 0.6 | ENCODE | 16 | +29.4 | 29406 | 1.9 | SCRT1 PKNOX1 FEZF1 ZNF404 OSR2 HIC1 PRDM6 BCL6B SCRT2 PRDM1 | CFTR ENSG00000237974 GC07P117564 GC07P117565 |
| GH07G116809 | 1.9 | FANTOM5 Ensembl ENCODE dbSUPER | 4.7 | -654.3 | -654314 | 4.5 | PKNOX1 FOXA2 MLX ARNT ARID4B FEZF1 DMAP1 ZNF2 YY1 SLC30A9 | MET CFTR CAPZA2 LOC100418716 |
| GH07G117435 | 0.8 | ENCODE | 10.9 | -30.1 | -30113 | 0.2 | PKNOX1 RELA ARID3A CBX5 EED FOS ETV6 RELB IKZF2 CREM | CFTR ASZ1 LOC100130680 |
| GH07G117488 | 0.7 | ENCODE | 12 | +23.8 | 23769 | 2.2 | NFIA CEBPB EP300 RAD21 YY1 NR2F2 JUND HNF1A ZNF316 ATF3 | CFTR ENSG00000237974 GC07P117565 GC07P117564 |
- Transcription factor binding sites by QIAGEN in the CFTR gene promoter:
Regulatory Element Products
Genomic Location for CFTR Gene
- Chromosome:
- 7
- Start:
- 117,465,784 bp from pter
- End:
- 117,715,971 bp from pter
- Size:
- 250,188 bases
- Orientation:
- Plus strand
Genomic View for CFTR Gene
- Cytogenetic band:
-
- 7q31.2 by Ensembl
- 7q31.2 by Entrez Gene
- 7q31.2 by HGNC
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CFTR Gene
Proteins for CFTR Gene
-
Protein details for CFTR Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P13569-CFTR_HUMAN
- Recommended name:
- Cystic fibrosis transmembrane conductance regulator
- Protein Accession:
- P13569
- Q20BG8
- Q20BH2
- Q2I0A1
- Q2I102
Protein attributes for CFTR Gene
- Size:
- 1480 amino acids
- Molecular mass:
- 168142 Da
- Quaternary structure:
-
- Monomer; does not require oligomerization for channel activity (PubMed:11524016). May form oligomers in the membrane (PubMed:11524016). Interacts with SLC26A3, SLC26A6 and SHANK2 (By similarity). Interacts with SLC9A3R1 and MYO6 (PubMed:12403779, PubMed:15247260, PubMed:11304524). Interacts (via C-terminus) with GOPC (via PDZ domain); this promotes CFTR internalization and thereby decreases channel activity (PubMed:11707463, PubMed:16331976). Interacts with SLC4A7 through SLC9A3R1 (PubMed:12403779). Found in a complex with MYO5B and RAB11A (PubMed:17462998). Interacts with ANO1 (PubMed:22178883). Interacts with SLC26A8 (PubMed:22121115). Interacts with AHCYL1; the interaction increases CFTR activity (By similarity). Interacts with CSE1L (PubMed:20933420).
Three dimensional structures from OCA and Proteopedia for CFTR Gene
Protein Expression for CFTR Gene
Selected DME Specific Peptides for CFTR Gene
- P13569:
-
- WRKAFGVI
- FKIERGQL
- GMQMRIA
- LIVIGAIAVV
- VTFISILTTG
- IERGQLLA
- FLIVLAL
- SIDVDSLMRSVSR
- SLVVLWLL
- ETKKQSFKQTGE
- FVLVDGG
- ACQLEEDI
- KVMIIEN
- VTAFWEE
- DVDSLMR
- TSQQLKQLES
- VVMENVTA
- ERSIAIYL
- PQIAALKEETEEEV
- FRGLPLVHTLITVSK
- VGIILTLAMNIM
- SVKAYCWE
- HKSLIFVLIWCL
- SYAVIIT
- LGRIIASY
- ELKLTRK
- LILHEGS
- TYQIIRR
- SKKNPKL
- DQEIWKVA
- QDKGNST
- WKVADEVGL
- GGILNRFSKDIA
- WIMPGTIK
- FISILTTGEGEG
- LEREWDRE
- FVVFLSVLPYAL
- FFSNFSL
- LYLGEVTK
- WFLYLSTLRWFQMRIEMIFVIFFIAVTFISILT
- FLVIEENKVRQYDS
- LMRSVSRVFK
- YYVFYIYVGVAD
- STKPYKNGQL
- NQGQNIHR
- DIYSRRLSQ
- KYRDQRA
- LLGTPVLKDI
- NISFSIS
- YFYGTFSEL
- LSNNLNKFDEGLALAHFVWI
- AFADCTVIL
- QAISPSDR
- LEYNLTTT
- RRQSVLNLMT
- SVIEQFPG
- LECQQFLVIE
- KILLLDE
- PDSEQGE
- LLQASAF
- LWLLGNT
- SPLEKAS
- VLSHGHKQL
- GQRVGLLGRTG
- QLLLIVIGA
- AKYTEGGN
- NSIRKFS
- SIQKLLNE
- SKLFFSW
- VIITSTS
- FVLIWCLV
- SLAPQANL
- LRKIFTTISF
- SLLSNNLNKFDEGLALAHF
- AFLRLLNT
- YKDADLYLLDSPF
- LKDINFK
- LENISFS
- KDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSP
- KDLTAKY
- KEIFESC
- TLQWAVN
- LLMGLIW
- PDFSSKLMG
- QLSKVMI
- GLEISEEINEEDLKECF
- RCFFWRF
- RKNLDPY
- GIEEDSD
- LQAPMST
- FSLIYKK
- SLFRQAIS
- LDDLLPLTIFDF
- LLDEPSAHLDP
- KAAYVRY
- ILPRISVI
- GEIQIDGVSWDS
- PILRKGYR
- SSRVLDKI
- KGYRQRLE
- TTWNTYLR
- FCGLGFLI
- TGSGKSTL
- FYIYVGVADTLLA
- RSPIFTHL
- GKIKHSGRIS
- AERRNSI
- VLDKISI
- GEAILPR
- GKSTLLSA
- EHRIEAML
- TKAVQPL
- LPLTIFDFIQL
- DIWPSGG
- GHKQLMCLARS
- VLKDINF
Post-translational modifications for CFTR Gene
- N-glycosylated.
- Phosphorylated; cAMP treatment promotes phosphorylation and activates the channel (PubMed:12588899, PubMed:17036051, PubMed:8910473). Dephosphorylation decreases the ATPase activity (in vitro) (PubMed:8910473). Phosphorylation at PKA sites activates the channel (PubMed:10792060, PubMed:12519745, PubMed:12588899, PubMed:25330774). Phosphorylation at PKC sites enhances the response to phosphorylation by PKA (PubMed:12588899). Phosphorylated by AMPK; this inhibits channel activity (PubMed:12519745).
- Ubiquitinated, leading to its degradation in the lysosome (PubMed:19398555). Deubiquitination by USP10 in early endosomes enhances its endocytic recycling to the cell membrane (PubMed:19398555). Ubiquitinated by RNF185 during ER stress (PubMed:24019521).
- Ubiquitination at posLast=688688
- Glycosylation at posLast=894894 and Asn900
- Modification sites at PhosphoSitePlus
Other Protein References for CFTR Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore top CFTR Antibody
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for CFTR
- R&D Systems Antibodies for CFTR (CFTR)
- Cell Signaling Technology (CST) Antibodies for CFTR (CFTR)
-
Custom Antibody ServicesOriGene Antibodies for CFTR
- Novus Biologicals Antibodies for CFTR
- Invitrogen Antibodies for CFTR
- antibodies-online Antibodies for CFTR: See all 90
- GeneTex CFTR antibody for CFTR
-
Custom Antibody ServicesProSci Antibodies for CFTR
-
Santa Cruz Biotechnology (SCBT) Antibodies for CFTR
Protein Products
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for CFTR
- Origene Custom Protein Services for CFTR
- Novus Biologicals proteins for CFTR
- Search GeneTex for Proteins for CFTR
Assay Products
- antibodies-online Kits for CFTR: See all 37
Domains & Families for CFTR Gene
Gene Families for CFTR Gene
Protein Domains for CFTR Gene
Suggested Antigen Peptide Sequences for CFTR Gene
- GenScript: Design optimal peptide antigens:
-
- cAMP-dependent chloride channel (CFTR_HUMAN)
- Cystic fibrosis transmembrane conductance regulator (O00717_HUMAN)
- Cystic fibrosis protein (Q16049_HUMAN)
- Cystic fibrosis transmembrane conductance regulator ATP-binding cassette sub-family C member 7 mutant (Q19Q54_HUMAN)
- Cystic fibrosis transmembrane conductance regulator ATP-binding cassette sub-family C member 7 (Q20BH0_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P13569UniProtKB/Swiss-Prot:
CFTR_HUMAN :- Binds and hydrolyzes ATP via the two cytoplasmic ABC transporter nucleotide-binding domains (PubMed:15284228). The two ATP-binding domains interact with each other, forming a head-to-tail dimer (PubMed:17036051). Normal ATPase activity requires interaction between the two domains (PubMed:15284228). The first ABC transporter nucleotide-binding domain has no ATPase activity by itself (By similarity).
- Belongs to the ABC transporter superfamily. ABCC family. CFTR transporter (TC 3.A.1.202) subfamily.
- Domain:
-
- Binds and hydrolyzes ATP via the two cytoplasmic ABC transporter nucleotide-binding domains (PubMed:15284228). The two ATP-binding domains interact with each other, forming a head-to-tail dimer (PubMed:17036051). Normal ATPase activity requires interaction between the two domains (PubMed:15284228). The first ABC transporter nucleotide-binding domain has no ATPase activity by itself (By similarity).
- The PDZ-binding motif mediates interactions with GOPC and with the SLC4A7, SLC9A3R1/EBP50 complex.
- The R region is intrinsically disordered (PubMed:10792060, PubMed:17660831). It mediates channel activation when it is phosphorylated, but not in the absence of phosphorylation (PubMed:10792060).
- Family:
-
- Belongs to the ABC transporter superfamily. ABCC family. CFTR transporter (TC 3.A.1.202) subfamily.
Function for CFTR Gene
Molecular function for CFTR Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + H(2)O = ADP + phosphate.
- UniProtKB/Swiss-Prot Function:
- Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis (PubMed:26823428). Mediates the transport of chloride ions across the cell membrane (PubMed:10792060, PubMed:11524016, PubMed:11707463, PubMed:12519745, PubMed:15010471, PubMed:12588899, PubMed:17036051, PubMed:19398555, PubMed:19621064, PubMed:22178883, PubMed:25330774, PubMed:1712898, PubMed:8910473, PubMed:9804160, PubMed:12529365, PubMed:17182731, PubMed:26846474, PubMed:28087700). Channel activity is coupled to ATP hydrolysis (PubMed:8910473). The ion channel is also permeable to HCO(3-); selectivity depends on the extracellular chloride concentration (PubMed:15010471, PubMed:19019741). Exerts its function also by modulating the activity of other ion channels and transporters (PubMed:12403779, PubMed:22178883, PubMed:22121115, PubMed:27941075). Plays an important role in airway fluid homeostasis (PubMed:16645176, PubMed:19621064, PubMed:26823428). Contributes to the regulation of the pH and the ion content of the airway surface fluid layer and thereby plays an important role in defense against pathogens (PubMed:14668433, PubMed:16645176, PubMed:26823428). Modulates the activity of the epithelial sodium channel (ENaC) complex, in part by regulating the cell surface expression of the ENaC complex (PubMed:17434346, PubMed:27941075, PubMed:17182731). Inhibits the activity of the ENaC channel containing subunits SCNN1A, SCNN1B and SCNN1G (PubMed:17182731). Inhibits the activity of the ENaC channel containing subunits SCNN1D, SCNN1B and SCNN1G, but not of the ENaC channel containing subunits SCNN1A, SCNN1B and SCNN1G (PubMed:27941075). May regulate bicarbonate secretion and salvage in epithelial cells by regulating the transporter SLC4A7 (PubMed:12403779). Can inhibit the chloride channel activity of ANO1 (PubMed:22178883). Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation (PubMed:19923167, PubMed:27714810).
Enzyme Numbers (IUBMB) for CFTR Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005254 | chloride channel activity | IEA,IMP | 19621064 |
| GO:0005260 | channel-conductance-controlling ATPase activity | NAS,IEA | 11707463 |
| GO:0005515 | protein binding | IPI | 9671706 |
| GO:0005524 | ATP binding | IEA | -- |
| GO:0015106 | bicarbonate transmembrane transporter activity | ISS | -- |
Phenotypes for CFTR Gene
- MGI mutant phenotypes for CFTR:
-
inferred from 17 alleles
- mortality/aging
- behavior/neurological phenotype
- normal phenotype
- growth/size/body region phenotype
- immune system phenotype
- homeostasis/metabolism phenotype
- respiratory system phenotype
- digestive/alimentary phenotype
- reproductive system phenotype
- endocrine/exocrine gland phenotype
- vision/eye phenotype
- hematopoietic system phenotype
- liver/biliary system phenotype
- craniofacial phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for CFTR:
Animal Models for CFTR Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for CFTR
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CFTR gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CFTR gene
- Search ViGene Biosciences for CFTR
CRISPR Products
-
OriGene CRISPR knockouts for CFTR
-
Santa Cruz Biotechnology (SCBT) CRISPR for CFTR
- GenScript: Design CRISPR guide RNA sequences for CFTR
miRNA for CFTR Gene
- miRTarBase miRNAs that target CFTR
miRNA Products
- Search ViGene Biosciences for CFTR
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CFTR
- Browse OriGene Inhibitory RNA Products For CFTR
-
ViGene Biosciences ready-to-package AAV shRNAs for CFTR gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CFTR
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CFTR
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for CFTR
-
ViGene Biosciences adenoviral particle packaged cDNA for CFTR gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CFTR gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CFTR gene
Flow Cytometry Products
No data available for Transcription Factor Targets and HOMER Transcription for CFTR Gene
Localization for CFTR Gene
Subcellular locations from UniProtKB/Swiss-Prot for CFTR Gene
- Apical cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The channel is internalized from the cell surface into an endosomal recycling compartment, from where it is recycled to the cell membrane (PubMed:17462998, PubMed:19398555, PubMed:20008117, Ref.?). In the oviduct and bronchus, detected on the apical side of epithelial cells, but not associated with cilia (PubMed:22207244). {ECO:0000269 PubMed:19398555, ECO:0000269 PubMed:20008117, ECO:0000269 PubMed:22207244, ECO:0000305 PubMed:17462998}.
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005737 | cytoplasm | IDA | 18570918 |
| GO:0005765 | lysosomal membrane | TAS | -- |
| GO:0005768 | endosome | IEA | -- |
| GO:0005769 | early endosome | IDA | 19398555 |
| GO:0005789 | endoplasmic reticulum membrane | TAS | -- |
Pathways & Interactions for CFTR Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | CDK-mediated phosphorylation and removal of Cdc6 |
.32
|
|
| 2 | Delta508-CFTR traffic / ER-to-Golgi in CF | ||
| 3 | Bacterial infections in CF airways | ||
| 4 | Regulation of CFTR activity (norm and CF) | ||
| 5 | Clathrin-mediated endocytosis | ||
Pathways by source for CFTR Gene
1 Cell Signaling Technology pathway for CFTR Gene
18 Reactome pathways for CFTR Gene
1 PharmGKB pathway for CFTR Gene
8 KEGG pathways for CFTR Gene
28 GeneGo (Thomson Reuters) pathways for CFTR Gene
1 R&D Systems pathway for CFTR Gene
2 Qiagen pathways for CFTR Gene
Interacting Proteins for CFTR Gene
SIGNOR curated interactions for CFTR Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006695 | cholesterol biosynthetic process | IEA | -- |
| GO:0006810 | transport | IEA | -- |
| GO:0006811 | ion transport | IEA | -- |
| GO:0006821 | chloride transport | IEA | -- |
| GO:0006904 | vesicle docking involved in exocytosis | IEA | -- |
Drugs & Compounds for CFTR Gene
(153) Drugs for CFTR Gene - From: DrugBank, PharmGKB, ClinicalTrials, ApexBio, DGIdb, FDA Approved Drugs, IUPHAR, HMDB, and Novoseek
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Glyburide | Approved | Pharma | Channel blocker, blocker, Target, antagonist | Kir6 (KATP) channel blocker | 114 | |
| Ivacaftor | Approved | Pharma | Target, potentiator | 0 | ||
| Bumetanide | Approved | Pharma | Agonist, Target, antagonist | NKCC cotransporter inhibitor, Na+/2Cl-/K+ (NKCC) symporter inhibitor | 17 | |
| Crofelemer | Approved | Pharma | Target, antagonist | 0 | ||
| Capsaicin | Approved | Pharma | Potentiation, Activator, activator | TRPV1 receptor agonist | 176 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| SF-01 |
|
Potentiation, Activator |
|
|
||
| VX-770 |
|
Potentiation, Activator |
|
|
||
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| Chloride ion |
|
16887-00-6 |
|
|||
| Hydrogen carbonate |
|
71-52-3 |
|
(1) Tocris Compounds for CFTR Gene
| Compound | Action | Cas Number |
|---|---|---|
| GlyH 101 | Reversible, voltage-dependent CFTR chloride channel blocker | 328541-79-3 |
(14) ApexBio Compounds for CFTR Gene
| Compound | Action | Cas Number |
|---|---|---|
| CFTRinh-172 | 307510-92-5 | |
| DCEBIO | 60563-36-2 | |
| GlyH-101 | CFTR Inhibitor II | 328541-79-3 |
| IOWH-032 | Potent CFTR inhibtor | 1191252-49-9 |
| Ivacaftor (VX-770) | Potent CFTR inhibtor | 873054-44-5 |
| Ivacaftor benzenesulfonate | CFTR Potentiator | 1134822-09-5 |
| Ivacaftor hydrate | CFTR Potentiator | 1134822-07-3 |
| KM 11060 | 774549-97-2 | |
| Lubiprostone | 136790-76-6 | |
| PG 01 | 853138-65-5 | |
| PPQ-102 | 931706-15-9 | |
| PTC124 (Ataluren) | CFTR-G542X nonsense allele inhibitor | 775304-57-9 |
| VX-661 | F508del CFTR corrector | 1152311-62-0 |
| VX-809 | CFTR corrector | 936727-05-8 |
Drug Products
- ApexBio compounds for CFTR
Transcripts for CFTR Gene
mRNA/cDNA for CFTR Gene
- (5) REFSEQ mRNAs :
- (87) Selected AceView cDNA sequences:
- (11) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for CFTR
-
Santa Cruz Biotechnology (SCBT) CRISPR for CFTR
- GenScript: Design CRISPR guide RNA sequences for CFTR
miRNA Products
- Search ViGene Biosciences for CFTR
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CFTR
- Browse OriGene Inhibitory RNA Products For CFTR
-
ViGene Biosciences ready-to-package AAV shRNAs for CFTR gene
Clone Products
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CFTR
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CFTR
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
Expression for CFTR Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Lung (Respiratory System)
- Alveolar Epithelial Type 2 Cells Alveoli
- Cilliated Cells Respiratory Bronchioles
- Cilliated Cells Trachea
- Early proximal lung progenitors(Wong AP et. al. 2012)
- Lung Epithelial Progenitors(Longmire TA et. al. 2012)
-
Epithelial Cells
- Alveolar Epithelial Type 2 Cells Alveoli
- Early Ameloblasts Dental Enamel
- Cilliated Cells Respiratory Bronchioles
- Biliary Epithelial Cells Intrahepatic Biliary Tree
- Duct Cells Pancreatic Ducts
-
Tooth (Integumentary System)
- Early Ameloblasts Dental Enamel
- Ameloblasts Dental Enamel
-
Liver (Hepatobiliary System)
- Biliary Epithelial Cells Intrahepatic Biliary Tree
- Hepatocyte-like cells(Si-Tayeb K et. al. 2010)
-
Pancreas (Endocrine System)
- Duct Cells Pancreatic Ducts
- Bone (Muscoskeletal System)
-
Colon (Gastrointestinal Tract)
-
Gall Bladder (Hepatobiliary System)
mRNA differential expression in normal tissues according to GTEx for CFTR Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for CFTR Gene
NURSA nuclear receptor signaling pathways regulating expression of CFTR Gene:
CFTRSOURCE GeneReport for Unigene cluster for CFTR Gene:
Hs.489786mRNA Expression by UniProt/SwissProt for CFTR Gene:
P13569-CFTR_HUMANEvidence on tissue expression from TISSUES for CFTR Gene
- Intestine(4.2)
- Lung(3.6)
- Pancreas(3.4)
- Gall bladder(2.9)
- Blood(2.4)
- Kidney(2.4)
- Liver(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for CFTR Gene
- ectoderm
- endoderm
- mesoderm
- cardiovascular
- digestive
- endocrine
- immune
- integumentary
- lymphatic
- nervous
- reproductive
- respiratory
- skeletal muscle
- urinary
- brain
- ear
- eye
- head
- bronchus
- diaphragm
- esophagus
- heart
- lung
- biliary tract
- duodenum
- intestine
- kidney
- large intestine
- liver
- pancreas
- small intestine
- spleen
- stomach
- anus
- ovary
- rectum
- testicle
- blood
- blood vessel
- coagulation system
- peripheral nerve
- peripheral nervous system
- skin
- sweat gland
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for CFTR
Orthologs for CFTR Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | CFTR 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | CFTR 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | CFTR 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | CFTR 35 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | CFTR 35 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Cftr 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Cftr 34 |
|
||
| chicken (Gallus gallus) |
Aves | CFTR 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | CFTR 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | cftr 34 |
|
||
| Str.13945 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | cftr-A 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | cftr 34 35 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | CG4562 35 |
|
OneToMany | |
| CG5789 35 |
|
OneToMany | |||
| CG10505 35 |
|
OneToMany | |||
| CG11897 35 |
|
OneToMany | |||
| CG11898 35 |
|
OneToMany | |||
| worm (Caenorhabditis elegans) |
Secernentea | mrp-6 35 |
|
OneToMany | |
| mrp-5 35 |
|
OneToMany | |||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | YOR1 35 |
|
OneToOne | |
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
OneToOne |
- Species where no ortholog for CFTR was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for CFTR Gene
Paralogs for CFTR Gene
(27) SIMAP similar genes for CFTR Gene using alignment to 52 proteins:
- CFTR_HUMAN
- C9J6L5_HUMAN
- E7EPB6_HUMAN
- H0Y8A9_HUMAN
- M0QYZ3_HUMAN
- O00717_HUMAN
- Q19Q54_HUMAN
- Q20BH0_HUMAN
- Q20BI4_HUMAN
- Q20BI6_HUMAN
- Q20BJ8_HUMAN
- Q2I0A3_HUMAN
- Q2I0A9_HUMAN
- Q5I6F9_HUMAN
- Q5I6N4_HUMAN
- Q5I6N5_HUMAN
- Q5I6N6_HUMAN
- Q5I6N7_HUMAN
- Q6KE95_HUMAN
- Q6KEA0_HUMAN
- Q6KEA5_HUMAN
- Q6KEB2_HUMAN
- Q6KEB8_HUMAN
- Q6KEC3_HUMAN
- Q6KEC8_HUMAN
- Q6KED3_HUMAN
- Q6KED8_HUMAN
- Q6KEE3_HUMAN
- Q6KEE7_HUMAN
- Q6KEF1_HUMAN
- Q6KEF5_HUMAN
- Q6KEF9_HUMAN
- Q6KEG3_HUMAN
- Q6KEG6_HUMAN
- Q6KEG9_HUMAN
- Q6KEH3_HUMAN
- Q6KEH6_HUMAN
- Q6KEH8_HUMAN
- Q6KEH9_HUMAN
- Q6KEI2_HUMAN
- Q6KEI7_HUMAN
- Q6KEI8_HUMAN
- Q6KEJ1_HUMAN
- Q6KEJ4_HUMAN
- Q6KEJ7_HUMAN
- Q99989_HUMAN
- Q9NP06_HUMAN
- Q9NP07_HUMAN
- Q9UJ19_HUMAN
- Q9UML7_HUMAN
- Q9UML8_HUMAN
- Q9UMN4_HUMAN
Pseudogenes.org Pseudogenes for CFTR Gene
Variants for CFTR Gene
| SNP ID | Clin | Chr 07 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs113993958 | Pathogenic, Cystic fibrosis (CF) [MIM:219700] | 117,530,953(+) | CCTAT(C/G/T)ACCCG | reference, missense | |
| rs115545701 | Likely pathogenic, Cystic fibrosis (CF) [MIM:219700] | 117,509,089(+) | CCCTT(C/T)GGCGA | reference, missense, utr-variant-5-prime | |
| rs11971167 | other, Cystic fibrosis (CF) [MIM:219700] | 117,642,528(+) | AGATC(A/G/T)ATGGT | reference, missense | |
| rs121908750 | Pathogenic, Cystic fibrosis (CF) [MIM:219700] | 117,509,140(+) | ATTTA(A/G)GGGTA | reference, missense | |
| rs121908751 | Pathogenic, Cystic fibrosis (CF) [MIM:219700] | 117,530,899(+) | TGTAG(A/G/T)AAGTC | reference, missense, stop-gained |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1325e214 | CNV | loss | 21293372 |
| esv2735064 | CNV | deletion | 23290073 |
| esv3614714 | CNV | loss | 21293372 |
| esv3614715 | CNV | loss | 21293372 |
| esv3614720 | CNV | loss | 21293372 |
| esv3891197 | CNV | loss | 25118596 |
| nsv5917 | CNV | insertion | 18451855 |
| nsv608257 | CNV | loss | 21841781 |
| nsv7405 | OTHER | inversion | 18451855 |
| nsv966878 | CNV | duplication | 23825009 |
Relevant External Links for CFTR Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CFTR Gene
Disorders for CFTR Gene
(63) MalaCards diseases for CFTR Gene - From: OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| cystic fibrosis |
|
|
| congenital bilateral absence of vas deferens |
|
|
| bronchiectasis with or without elevated sweat chloride 1 |
|
|
| pancreatitis, hereditary |
|
|
| idiopathic bronchiectasis |
|
|
UniProtKB/Swiss-Prot
CFTR_HUMAN- Congenital bilateral absence of the vas deferens (CBAVD) [MIM:277180]: Important cause of sterility in men and could represent an incomplete form of cystic fibrosis, as the majority of men suffering from cystic fibrosis lack the vas deferens. {ECO:0000269 PubMed:10651488, ECO:0000269 PubMed:7529962, ECO:0000269 PubMed:7539342, ECO:0000269 PubMed:9067761, ECO:0000269 PubMed:9736778, ECO:0000269 Ref.109}. Note=The disease is caused by mutations affecting the gene represented in this entry.
- Cystic fibrosis (CF) [MIM:219700]: A common generalized disorder of the exocrine glands which impairs clearance of secretions in a variety of organs. It is characterized by the triad of chronic bronchopulmonary disease (with recurrent respiratory infections), pancreatic insufficiency (which leads to malabsorption and growth retardation) and elevated sweat electrolytes. It is the most common genetic disease in Caucasians, with a prevalence of about 1 in 2000 live births. Inheritance is autosomal recessive. {ECO:0000269 PubMed:10094564, ECO:0000269 PubMed:12529365, ECO:0000269 PubMed:1284466, ECO:0000269 PubMed:1284468, ECO:0000269 PubMed:1284529, ECO:0000269 PubMed:1284530, ECO:0000269 PubMed:1284548, ECO:0000269 PubMed:15528182, ECO:0000269 PubMed:15716351, ECO:0000269 PubMed:1695717, ECO:0000269 PubMed:1699669, ECO:0000269 PubMed:1710600, ECO:0000269 PubMed:1712898, ECO:0000269 PubMed:17182731, ECO:0000269 PubMed:20008117, ECO:0000269 PubMed:20150177, ECO:0000269 PubMed:2236053, ECO:0000269 PubMed:25330774, ECO:0000269 PubMed:26846474, ECO:0000269 PubMed:28001373, ECO:0000269 PubMed:28087700, ECO:0000269 PubMed:7504969, ECO:0000269 PubMed:7505694, ECO:0000269 PubMed:7513296, ECO:0000269 PubMed:7517264, ECO:0000269 PubMed:7520022, ECO:0000269 PubMed:7522211, ECO:0000269 PubMed:7524909, ECO:0000269 PubMed:7524913, ECO:0000269 PubMed:7525450, ECO:0000269 PubMed:7537150, ECO:0000269 PubMed:7541273, ECO:0000269 PubMed:7541510, ECO:0000269 PubMed:7543567, ECO:0000269 PubMed:7544319, ECO:0000269 PubMed:7581407, ECO:0000269 PubMed:7680525, ECO:0000269 PubMed:7683628, ECO:0000269 PubMed:7683954, ECO:0000269 PubMed:8081395, ECO:0000269 PubMed:8522333, ECO:0000269 PubMed:8723693, ECO:0000269 PubMed:8723695, ECO:0000269 PubMed:8800923, ECO:0000269 PubMed:8829633, ECO:0000269 PubMed:8910473, ECO:0000269 PubMed:8956039, ECO:0000269 PubMed:9101301, ECO:0000269 PubMed:9222768, ECO:0000269 PubMed:9375855, ECO:0000269 PubMed:9401006, ECO:0000269 PubMed:9443874, ECO:0000269 PubMed:9452048, ECO:0000269 PubMed:9452054, ECO:0000269 PubMed:9452073, ECO:0000269 PubMed:9482579, ECO:0000269 PubMed:9521595, ECO:0000269 PubMed:9554753, ECO:0000269 PubMed:9736778, ECO:0000269 PubMed:9804160, ECO:0000269 PubMed:9921909}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Relevant External Links for CFTR
No data available for Genatlas for CFTR Gene
Publications for CFTR Gene
- Association analyses of genetic polymorphisms of GSTM1, GSTT1, NQO1, NAT2, LPL, PRSS1, PSTI, and CFTR with chronic alcoholic pancreatitis in Japan. (PMID: 18986377) Maruyama K. … Otsuki M. (Alcohol. Clin. Exp. Res. 2010) 3 22 46 64
- Connections between genetics and clinical data: Role of MCP-1, CFTR, and SPINK-1 in the setting of acute, acute recurrent, and chronic pancreatitis. (PMID: 19844201) Cavestro G.M. … Di Mario F. (Am. J. Gastroenterol. 2010) 3 22 46 64
- Cystic fibrosis transmembrane conductance regulator (CFTR) gene mutations and risk for pancreatic adenocarcinoma. (PMID: 19885835) McWilliams R.R. … Highsmith W.E. (Cancer 2010) 3 22 46 64
- Genetic analysis of Rwandan patients with cystic fibrosis-like symptoms: identification of novel cystic fibrosis transmembrane conductance regulator and epithelial sodium channel gene variants. (PMID: 19017867) Mutesa L. … Bours V. (Chest 2009) 3 22 46 64
- The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells. (PMID: 19398555) Bomberger J.M. … Stanton B.A. (J. Biol. Chem. 2009) 3 4 22 64
Products for CFTR Gene
- R&D Systems Antibodies for CFTR (CFTR)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CFTR
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for CFTR
- Origene Custom Protein Services for CFTR
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CFTR
- Browse OriGene Inhibitory RNA Products For CFTR
- OriGene qPCR primer pairs for CFTR
- OriGene CRISPR knockouts for CFTR
- OriGene ORF clones in human for CFTR
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CFTR
- GenScript: Next-day shipping cDNA ORF clone for CFTR in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CFTR
- GenScript Custom Assay Services for CFTR
- GenScript Custom overexpressing Cell Line Services for CFTR
- GenScript: Design CRISPR guide RNA sequences for CFTR
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CFTR
- Cell Signaling Technology (CST) Antibodies for CFTR (CFTR)
- Search for Antibodies & Assays
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for CFTR
- Novus Biologicals proteins for CFTR
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Invitrogen Antibodies for CFTR
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for CFTR
- antibodies-online Antibodies for CFTR: See all 90
- antibodies-online Kits for CFTR: See all 37
- Search antibodies-online for proteins
- Search antibodies-online for peptides
- GeneTex CFTR antibody for CFTR
- Search GeneTex for Proteins for CFTR
- ViGene Biosciences adenoviral particle packaged cDNA for CFTR gene
- ViGene Biosciences lentiviral particle packaged cDNA for CFTR gene
- ViGene Biosciences ready-to-package AAV shRNAs for CFTR gene
- Search ViGene Biosciences for CFTR
- Santa Cruz Biotechnology (SCBT) Antibodies for CFTR
- Search Santa Cruz Biotechnology (SCBT) for CFTR siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for CFTR
- Custom Antibody ServicesProSci Antibodies for CFTR
- Search for CFTR Proteins at ProSci
- Horizon Cell Lines for CFTR
- Cyagen custom Knockout/knockin (KOKI) mouse models for CFTR
- VectorBuilder custom plasmid, inducible vectors for CFTR
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CFTR
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for CFTR Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer




