Aliases for CBLL1 Gene
Aliases for CBLL1 Gene
- Cbl Proto-Oncogene Like 1 2 3 5
- Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence-Like 1 2 3
- Casitas B-Lineage Lymphoma-Transforming Sequence-Like Protein 1 3 4
- Cbl Proto-Oncogene Like 1, E3 Ubiquitin Protein Ligase 2 3
- RING-Type E3 Ubiquitin Transferase Hakai 3 4
- RING Finger Protein 188 3 4
- C-Cbl-Like Protein 1 3 4
- RNF188 3 4
- HAKAI 3 4
External Ids for CBLL1 Gene
- HGNC: 21225
- Entrez Gene: 79872
- Ensembl: ENSG00000105879
- OMIM: 606872
- UniProtKB: Q75N03
Previous GeneCards Identifiers for CBLL1 Gene
- GC07P106931
- GC07P106945
- GC07P106978
- GC07P107171
- GC07P107385
- GC07P101746
Summaries for CBLL1 Gene
-
This gene encodes an E3 ubiquitin-ligase for the E-cadherin complex and mediates its ubiquitination, endocytosis, and degradation in the lysosomes. The encoded protein contains a RING-finger domain and is also thought to have a role in control of cell proliferation. A related pseudogene has been identified on chromosome X. Alternative splicing results in a non-coding transcript variant. [provided by RefSeq, Aug 2011]
GeneCards Summary for CBLL1 Gene
CBLL1 (Cbl Proto-Oncogene Like 1) is a Protein Coding gene. Among its related pathways are HIV Life Cycle and Remodeling of Adherens Junctions. GO annotations related to this gene include nucleic acid binding and ligase activity. An important paralog of this gene is ZNF645.
UniProtKB/Swiss-Prot for CBLL1 Gene
-
Promotes ubiquitination of several tyrosine-phosphorylated Src substrates, including CDH1, CTTN and DOK1. Targets CDH1 for endocytosis and degradation.
No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CBLL1 Gene
Genomics for CBLL1 Gene
Regulatory Elements for CBLL1 Gene
Enhancers for CBLL1 Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around CBLL1 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Location for CBLL1 Gene
- Chromosome:
- 7
- Start:
- 107,743,497 bp from pter
- End:
- 107,762,011 bp from pter
- Size:
- 18,515 bases
- Orientation:
- Plus strand
Genomic View for CBLL1 Gene
Genes around CBLL1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 7q22.3 by Ensembl
- 7q22.3 by Entrez Gene
- 7q22.3 by HGNC
CBLL1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CBLL1 Gene
Proteins for CBLL1 Gene
-
Protein details for CBLL1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q75N03-HAKAI_HUMAN
- Recommended name:
- E3 ubiquitin-protein ligase Hakai
- Protein Accession:
- Q75N03
- B7ZM03
- Q8TAJ4
- Q9H5S6
Protein attributes for CBLL1 Gene
- Size:
- 491 amino acids
- Molecular mass:
- 54519 Da
- Quaternary structure:
-
- Homodimer. Interacts with tyrosine-phosphorylated SRC substrates. Component of the WTAP complex composed of WTAP, ZC3H13, CBLL1, KIAA1429, RBM15, BCLAF1 and THRAP3 (PubMed:24100041).
Protein Expression for CBLL1 Gene
Selected DME Specific Peptides for CBLL1 Gene
- Q75N03:
-
- YGRMIPCKHVFCYDCAILHEKKGDKMCPGC
- HPHHIMPPQQHYAPPPPPPPPISHP
- GLDVRRRIPIKLISK
- HPPQAAGTPH
- SMAPPPPR
- PVQRIEQC
- PPYMNHPPPGPPP
- APPPITPPPGHIIAQ
- QHVPHEH
- HSNLITVPIQDDSNSGARE
- WPAPRGPPP
- EDQGTLSPPFTQPGGMSPG
- RGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRA
- APPPHHYNP
Post-translational modifications for CBLL1 Gene
Other Protein References for CBLL1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for CBLL1
- Novus Biologicals Antibodies for CBLL1
- Invitrogen Antibodies for CBLL1
- antibodies-online Antibodies for CBLL1: See all 33
- GeneTex CBLL1 antibody for CBLL1
-
Santa Cruz Biotechnology (SCBT) Antibodies for CBLL1
Protein Products
-
OriGene Purified Proteins for CBLL1
- Search Origene for MassSpec and Protein Over-expression Lysates for CBLL1
- Origene Custom Protein Services for CBLL1
- antibodies-online Proteins for CBLL1: See all 6
- Search antibodies-online for peptides
- Search GeneTex for Proteins for CBLL1
Assay Products
- antibodies-online Kits for CBLL1: See all 3
Domains & Families for CBLL1 Gene
Gene Families for CBLL1 Gene
Protein Domains for CBLL1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for CBLL1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q75N03UniProtKB/Swiss-Prot:
HAKAI_HUMAN :- The HYB domain forms a phosphotyrosine-binding pocket upon dimerization, and mediates as well the recognition of its flanking acidic amino acids.
- Domain:
-
- The HYB domain forms a phosphotyrosine-binding pocket upon dimerization, and mediates as well the recognition of its flanking acidic amino acids.
Function for CBLL1 Gene
Molecular function for CBLL1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
- UniProtKB/Swiss-Prot Function:
- Promotes ubiquitination of several tyrosine-phosphorylated Src substrates, including CDH1, CTTN and DOK1. Targets CDH1 for endocytosis and degradation.
Enzyme Numbers (IUBMB) for CBLL1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003676 | nucleic acid binding | IEA | -- |
| GO:0004842 | ubiquitin-protein transferase activity | TAS | 14996930 |
| GO:0005515 | protein binding | IPI | 11836526 |
| GO:0008270 | zinc ion binding | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
Phenotypes for CBLL1 Gene
- GenomeRNAi human phenotypes for CBLL1:
-
- Decreased viability
- Lamellipodia cells
- Decreased viability ratio
- Decreased shRNA abundance (Z-score < -2)
- Decreased NF-kappaB reporter expression
- Increased shRNA abundance (Z-score > 2)
- Increased HPV16-GFP infection
- Decreased infection with West Nile virus (WNV)
- Decreased West Nile virus (WNV) infection
- Weakly decreased NFAT1-GFP nuclear translocation
- Decreased Dengue Infection
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for CBLL1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CBLL1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLL1 gene
- Search ViGene Biosciences for CBLL1
CRISPR Products
-
OriGene CRISPR knockouts for CBLL1
-
Santa Cruz Biotechnology (SCBT) CRISPR for CBLL1
- GenScript: Design CRISPR guide RNA sequences for CBLL1
miRNA for CBLL1 Gene
- miRTarBase miRNAs that target CBLL1
miRNA Products
- Search ViGene Biosciences for CBLL1
Inhibitory RNA Products
- Origene siRNA, RNAi, and shRNA products in human, mouse, rat for CBLL1
- Browse OriGene Inhibitory RNA Products For CBLL1
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLL1 gene
Clone Products
- Sino Biological Human cDNA Clone for CBLL1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CBLL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLL1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for CBLL1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CBLL1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLL1 gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CBLL1 Gene
Localization for CBLL1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for CBLL1 Gene
- Nucleus speckle. Nucleus, nucleoplasm.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| plasma membrane | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000151 | ubiquitin ligase complex | IC | 14996930 |
| GO:0005634 | nucleus | IEA | -- |
| GO:0005654 | nucleoplasm | IEA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0016607 | nuclear speck | IDA | -- |
Pathways & Interactions for CBLL1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | HIV Life Cycle |
.45
|
|
| 2 | Listeria monocytogenes entry into host cells | ||
| 3 | Remodeling of Adherens Junctions | ||
Pathways by source for CBLL1 Gene
4 Reactome pathways for CBLL1 Gene
1 Qiagen pathway for CBLL1 Gene
UniProtKB/Swiss-Prot Q75N03-HAKAI_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for CBLL1 Gene
Selected Interacting proteins:
ENSP00000401277
Q75N03-HAKAI_HUMAN
for CBLL1 Gene via
STRING
IID
MINT
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0007162 | negative regulation of cell adhesion | ISS | -- |
| GO:0016337 | single organismal cell-cell adhesion | IDA | 11836526 |
| GO:0016567 | protein ubiquitination | TAS | 14996930 |
| GO:0030155 | regulation of cell adhesion | IBA | -- |
| GO:0030335 | positive regulation of cell migration | ISS | -- |
No data available for SIGNOR curated interactions for CBLL1 Gene
Transcripts for CBLL1 Gene
mRNA/cDNA for CBLL1 Gene
- (6) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (75) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for CBLL1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for CBLL1
-
Santa Cruz Biotechnology (SCBT) CRISPR for CBLL1
- GenScript: Design CRISPR guide RNA sequences for CBLL1
miRNA Products
- Search ViGene Biosciences for CBLL1
Inhibitory RNA Products
- Origene siRNA, RNAi, and shRNA products in human, mouse, rat for CBLL1
- Browse OriGene Inhibitory RNA Products For CBLL1
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLL1 gene
Clone Products
- Sino Biological Human cDNA Clone for CBLL1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for CBLL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLL1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||
| SP2: | - | - | |||||||||||||||||
| SP3: | |||||||||||||||||||
| SP4: | |||||||||||||||||||
| SP5: | - | - | |||||||||||||||||
| SP6: | - |
Expression for CBLL1 Gene
This gene is overexpressed in CD8 Tcells (15.7), Peripheral blood mononuclear cells (13.6), and CD4 Tcells (10.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for CBLL1 Gene
NURSA nuclear receptor signaling pathways regulating expression of CBLL1 Gene:
CBLL1SOURCE GeneReport for Unigene cluster for CBLL1 Gene:
Hs.592271Evidence on tissue expression from TISSUES for CBLL1 Gene
- Lung(4.3)
- Nervous system(4)
- Intestine(2)
Primer Products
-
OriGene qPCR primer pairs for CBLL1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for CBLL1 Gene
Orthologs for CBLL1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | CBLL1 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | CBLL1 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | CBLL1 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | -- 35 |
|
ManyToMany | |
| -- 35 |
|
ManyToMany | |||
| rat (Rattus norvegicus) |
Mammalia | Cbll1 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Cbll1 34 16 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 35 |
|
OneToMany | |
| chicken (Gallus gallus) |
Aves | CBLL1 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | -- 35 |
|
OneToMany | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | cbll1 34 |
|
||
| Str.16186 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.3484 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | cbll1 35 |
|
ManyToMany | |
| CU041386.1 35 |
|
ManyToMany | |||
| LOC100002706 34 |
|
||||
| zgc55308 34 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Hakai 35 |
|
OneToMany |
- Species where no ortholog for CBLL1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for CBLL1 Gene
(1) SIMAP similar genes for CBLL1 Gene using alignment to 6 proteins:
Pseudogenes.org Pseudogenes for CBLL1 Gene
Variants for CBLL1 Gene
| SNP ID | Clin | Chr 07 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs183578733 | Uncertain significance | 107,765,469(+) | ACATC(C/T)ACTGT | downstream-variant-500B, utr-variant-3-prime | |
| rs1000065847 | -- | 107,746,372(+) | CTCAG(A/G)TGTCC | intron-variant, upstream-variant-2KB | |
| rs1000160253 | -- | 107,763,614(+) | AGCAG(A/C)TTAGG | utr-variant-3-prime | |
| rs1000185814 | -- | 107,764,646(+) | GGATT(A/G)CTTGA | utr-variant-3-prime | |
| rs1000362527 | -- | 107,760,340(+) | AAAAC(-/T)TTTAT | nc-transcript-variant, utr-variant-3-prime |
Residual Variation Intolerance Score:
6.08% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.54;
11.62% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for CBLL1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- CBLL1
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Structural Variations from Database of Genomic Variants (DGV) for CBLL1 Gene
Disorders for CBLL1 Gene
Relevant External Links for CBLL1
No disorders were found for CBLL1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CBLL1 Gene
Publications for CBLL1 Gene
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
- The DNA sequence of human chromosome 7. (PMID: 12853948) Hillier L.W. … Wilson R.K. (Nature 2003) 3 4 64
- Hakai, a c-Cbl-like protein, ubiquitinates and induces endocytosis of the E-cadherin complex. (PMID: 11836526) Fujita Y. … Birchmeier W. (Nat. Cell Biol. 2002) 2 3 64
- E-cadherin and Hakai: signalling, remodeling or destruction? (PMID: 11944035) Pece S. … Gutkind J.S. (Nat. Cell Biol. 2002) 2 3 64
- Panorama of ancient metazoan macromolecular complexes. (PMID: 26344197) Wan C. … Emili A. (Nature 2015) 3 64
Products for CBLL1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CBLL1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for CBLL1
- Search Origene for MassSpec and Protein Over-expression Lysates for CBLL1
- Origene Custom Protein Services for CBLL1
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CBLL1
- Browse OriGene Inhibitory RNA Products For CBLL1
- OriGene qPCR primer pairs for CBLL1
- OriGene CRISPR knockouts for CBLL1
- OriGene ORF clones in human for CBLL1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CBLL1
- GenScript: Next-day shipping cDNA ORF clone for CBLL1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CBLL1
- GenScript Custom Assay Services for CBLL1
- GenScript Custom overexpressing Cell Line Services for CBLL1
- GenScript: Design CRISPR guide RNA sequences for CBLL1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CBLL1
- Sino Biological Human cDNA Clone for CBLL1
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for CBLL1
- Novus Biologicals proteins and lysates for CBLL1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- antibodies-online Antibodies for CBLL1: See all 33
- antibodies-online Kits for CBLL1: See all 3
- antibodies-online Proteins for CBLL1: See all 6
- Search antibodies-online for peptides
- GeneTex CBLL1 antibody for CBLL1
- Search GeneTex for Proteins for CBLL1
- ViGene Biosciences adenoviral particle packaged cDNA for CBLL1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for CBLL1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for CBLL1 gene
- Search ViGene Biosciences for CBLL1
- Santa Cruz Biotechnology (SCBT) Antibodies for CBLL1
- Search Santa Cruz Biotechnology (SCBT) for CBLL1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for CBLL1
- Cyagen custom Knockout/knockin (KOKI) mouse models for CBLL1
- VectorBuilder custom plasmid, inducible vectors for CBLL1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLL1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for CBLL1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer