Aliases for CBLB Gene
Aliases for CBLB Gene
- Cbl Proto-Oncogene B 2 3 5
- Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence B 2 3
- Cbl Proto-Oncogene B, E3 Ubiquitin Protein Ligase 2 3
- Casitas B-Lineage Lymphoma Proto-Oncogene B 3 4
- RING-Type E3 Ubiquitin Transferase CBL-B 3 4
- Signal Transduction Protein CBL-B 3 4
- SH3-Binding Protein CBL-B 3 4
- RING Finger Protein 56 3 4
- RNF56 3 4
External Ids for CBLB Gene
- HGNC: 1542
- Entrez Gene: 868
- Ensembl: ENSG00000114423
- OMIM: 604491
- UniProtKB: Q13191
Previous GeneCards Identifiers for CBLB Gene
- GC03M102013
- GC03M104895
- GC03M106658
- GC03M106698
- GC03M106859
- GC03M105374
- GC03M102751
Summaries for CBLB Gene
GeneCards Summary for CBLB Gene
CBLB (Cbl Proto-Oncogene B) is a Protein Coding gene. Among its related pathways are ErbB signaling pathway and Innate Immune System. GO annotations related to this gene include calcium ion binding and ubiquitin-protein transferase activity. An important paralog of this gene is CBL.
UniProtKB/Swiss-Prot for CBLB Gene
-
E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. Slightly promotes SRC ubiquitination. May be involved in EGFR ubiquitination and internalization. May be functionally coupled with the E2 ubiquitin-protein ligase UB2D3.
No data available for Entrez Gene Summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CBLB Gene
Genomics for CBLB Gene
Regulatory Elements for CBLB Gene
Enhancers for CBLB Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH03G105826 | 1.7 | FANTOM5 Ensembl ENCODE dbSUPER | 28.5 | +40.3 | 40309 | 5.2 | TBP PKNOX1 WRNIP1 BMI1 RAD21 CBX5 ZNF207 FOS RELB IKZF2 | CBLB GC03M105835 GC03P105761 |
| GH03G105805 | 1.3 | Ensembl ENCODE dbSUPER | 21 | +63.2 | 63205 | 1.0 | JUN RAD21 RFX5 FOSL1 GATA2 FOSL2 NR2F6 NFE2 FOS NFE2L2 | CBLB GC03M105835 GC03P105761 |
| GH03G105800 | 1.2 | Ensembl ENCODE dbSUPER | 20.5 | +67.9 | 67945 | 2.5 | CTCF EBF1 RAD21 RELA EED SMC3 RELB CREM THAP11 GATAD2A | CBLB GC03M105835 GC03P105761 |
| GH03G105798 | 1.2 | Ensembl ENCODE dbSUPER | 20.1 | +70.8 | 70750 | 0.9 | CTCF PKNOX1 CEBPG BMI1 ARID3A CBX5 ETV6 RELB IKZF2 MTA2 | CBLB GC03P105761 GC03M105835 |
| GH03G105790 | 1.3 | Ensembl ENCODE dbSUPER | 18.4 | +77.4 | 77401 | 3.5 | ESRRA SIN3A MAX CEBPG RAD21 YY1 ZNF316 FOS MAFK NFE2L2 | CBLB GC03P105761 GC03M105835 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around CBLB on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the CBLB gene promoter:
Regulatory Element Products
Genomic Location for CBLB Gene
- Chromosome:
- 3
- Start:
- 105,655,461 bp from pter
- End:
- 105,869,552 bp from pter
- Size:
- 214,092 bases
- Orientation:
- Minus strand
Genomic View for CBLB Gene
Genes around CBLB on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 3q13.11 by Ensembl
- 3q13.11 by Entrez Gene
- 3q13.11 by HGNC
CBLB Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for CBLB Gene
Proteins for CBLB Gene
-
Protein details for CBLB Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13191-CBLB_HUMAN
- Recommended name:
- E3 ubiquitin-protein ligase CBL-B
- Protein Accession:
- Q13191
- A8K9S7
- B7WNM4
- Q13192
- Q13193
- Q3LIC0
- Q63Z43
- Q8IVC5
Protein attributes for CBLB Gene
- Size:
- 982 amino acids
- Molecular mass:
- 109450 Da
- Quaternary structure:
-
- Interacts with SH3 domain-containing proteins LCK, CRK and SORBS1. Interacts with LCP2 and ZAP70. May interact with CBL. Interacts with SH3 domain-containing proteins VAV1, FYN, FGR, PLCG1, GRB2, CRKL, PIK3R1 and SH3KBP1/CIN85. Identified in heterotrimeric complexes with SH3KBP1/CIN85, CD2AP and ARHGEF7, where one CBLB peptide binds two copies of the other protein. Interacts with poly-ubiquitinated proteins. Dimerization is required for the binding of poly-ubiquitin, but not for the binding of mono-ubiquitin. Interacts with EGFR (phosphorylated).
- Miscellaneous:
-
- This protein has one functional calcium-binding site.
- SequenceCaution:
-
- Sequence=BAE45748.1; Type=Erroneous termination; Positions=904; Note=Translated as Arg.; Evidence={ECO:0000305}; Sequence=CAH56175.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for CBLB Gene
Protein Expression for CBLB Gene
Selected DME Specific Peptides for CBLB Gene
- Q13191:
-
- LAVTHPGYMAFLTYDEVKARLQK
- NPDLTGLCEPTP
- VARSILREFAFPPPV
- LKNSPPYILD
- PLQIPHL
- LPDTYQHLR
- PRRTAPEIHHR
- GNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLT
- QAPARPPKP
- FRITKADAAEFWRK
- KPGSYIFRLSCTRLGQWAIGYVT
- FRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDI
- WKLMDKVVRLCQNPKL
- PPPPPERPPPIPPD
- RRNLTKLSLIFSHMLAE
- ENVDAKIAKLMGEG
- LFKEGKERMYEE
Post-translational modifications for CBLB Gene
- Auto-ubiquitinated upon EGF-mediated cell activation or upon T-cell costimulation by CD28; which promotes proteasomal degradation.
- Phosphorylated on tyrosine and serine residues upon TCR or BCR activation, and upon various types of cell stimulation.
- Ubiquitination at Lys97 and posLast=516516
- Modification sites at PhosphoSitePlus
Other Protein References for CBLB Gene
- ENSEMBL proteins:
- REFSEQ proteins:
-
- NP_001308715.1
- NP_001308717.1
- NP_001308718.1
- NP_001308719.1
- NP_001308720.1
- NP_001308722.1
- NP_001308723.1
- NP_001308724.1
- NP_001308725.1
- NP_001308726.1
- NP_001308727.1
- NP_001308728.1
- NP_001308735.1
- NP_001308736.1
- NP_001308737.1
- NP_001308740.1
- NP_001308742.1
- NP_001308745.1
- NP_001308749.1
- NP_001308751.1
- NP_733762.2
- XP_011511559.1
- XP_011511561.2
- XP_016862884.1
- XP_016862885.1
- XP_016862886.1
- XP_016862887.1
- XP_016862888.1
- XP_016862889.1
Antibody Products
- Cell Signaling Technology (CST) Antibodies for CBLB (Cbl-b)
-
Custom Antibody ServicesOriGene Antibodies for CBLB
- Novus Biologicals Antibodies for CBLB
-
Abcam antibodies for CBLB
- Invitrogen Antibodies for CBLB
- GeneTex CBLB antibody for CBLB
-
Santa Cruz Biotechnology (SCBT) Antibodies for CBLB
Protein Products
-
OriGene Purified Proteins for CBLB
- Search Origene for MassSpec and Protein Over-expression Lysates for CBLB
- Origene Custom Protein Services for CBLB
- Search GeneTex for Proteins for CBLB
Assay Products
Domains & Families for CBLB Gene
Gene Families for CBLB Gene
Protein Domains for CBLB Gene
Suggested Antigen Peptide Sequences for CBLB Gene
Graphical View of Domain Structure for InterPro Entry
Q13191UniProtKB/Swiss-Prot:
CBLB_HUMAN :- The N-terminus is composed of the phosphotyrosine binding (PTB) domain, a short linker region and the RING-type zinc finger. The PTB domain, which is also called TKB (tyrosine kinase binding) domain, is composed of three different subdomains: a four-helix bundle (4H), a calcium-binding EF hand and a divergent SH2 domain.
- Domain:
-
- The N-terminus is composed of the phosphotyrosine binding (PTB) domain, a short linker region and the RING-type zinc finger. The PTB domain, which is also called TKB (tyrosine kinase binding) domain, is composed of three different subdomains: a four-helix bundle (4H), a calcium-binding EF hand and a divergent SH2 domain.
- The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
- The UBA domain interacts with poly-ubiquitinated proteins.
Function for CBLB Gene
Molecular function for CBLB Gene
- GENATLAS Biochemistry:
- protein (109kDa),homolog to the proto-oncogene v-cbl,expressed in a variety of normal tissues,potentially interacting with signal transduction molecules,regulating in mouse,the CD28 dependence of T cell activation and putatively contributing to autoimmune diseases
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
- UniProtKB/Swiss-Prot Function:
- E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. Slightly promotes SRC ubiquitination. May be involved in EGFR ubiquitination and internalization. May be functionally coupled with the E2 ubiquitin-protein ligase UB2D3.
Enzyme Numbers (IUBMB) for CBLB Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0001784 | phosphotyrosine binding | IEA | -- |
| GO:0004842 | ubiquitin-protein transferase activity | IEA | -- |
| GO:0004871 | signal transducer activity | IEA | -- |
| GO:0005509 | calcium ion binding | IEA | -- |
| GO:0005515 | protein binding | IPI | 10022120 |
Phenotypes for CBLB Gene
- MGI mutant phenotypes for CBLB:
- inferred from 3 alleles
- GenomeRNAi human phenotypes for CBLB:
-
- Increased viability
- Decreased hepcidin::fluc mRNA expression
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased viability in esophageal squamous lineage
- Resistant to vaccinia virus (VACV-A4L) infection
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Increased cilium length after serum starvation
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for CBLB
-
-
ViGene Biosciences lentiviral particle packaged cDNA for CBLB gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLB gene
- Search ViGene Biosciences for CBLB
CRISPR Products
-
OriGene CRISPR knockouts for CBLB
-
Santa Cruz Biotechnology (SCBT) CRISPR for CBLB
- GenScript: Design CRISPR guide RNA sequences for CBLB
miRNA for CBLB Gene
- miRTarBase miRNAs that target CBLB
-
- hsa-mir-6885-3p (MIRT659788)
- hsa-mir-7162-5p (MIRT659789)
- hsa-mir-3977 (MIRT659790)
- hsa-mir-516b-3p (MIRT659791)
- hsa-mir-516a-3p (MIRT659792)
- hsa-mir-2115-5p (MIRT659793)
- hsa-mir-4762-5p (MIRT659794)
- hsa-mir-6833-3p (MIRT719543)
- hsa-mir-4768-5p (MIRT719544)
- hsa-mir-6873-3p (MIRT719545)
- hsa-mir-765 (MIRT719546)
- hsa-mir-4784 (MIRT719547)
- hsa-mir-3150b-3p (MIRT719548)
- hsa-mir-4635 (MIRT719549)
- hsa-mir-942-5p (MIRT719550)
- hsa-mir-6817-3p (MIRT719551)
- hsa-mir-7110-3p (MIRT719552)
- hsa-mir-151b (MIRT719553)
- hsa-mir-151a-5p (MIRT719554)
miRNA Products
- Search ViGene Biosciences for CBLB
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CBLB
- Browse OriGene Inhibitory RNA Products For CBLB
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLB gene
Clone Products
- Sino Biological Human cDNA Clone for CBLB
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for CBLB
- VectorBuilder custom plasmid, inducible vectors for CBLB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLB
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for CBLB
-
ViGene Biosciences adenoviral particle packaged cDNA for CBLB gene
-
ViGene Biosciences lentiviral particle packaged cDNA for CBLB gene
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLB gene
Flow Cytometry Products
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for CBLB Gene
Localization for CBLB Gene
Subcellular locations from UniProtKB/Swiss-Prot for CBLB Gene
- Cytoplasm. Note=Upon EGF stimulation, associates with endocytic vesicles.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 5 |
| plasma membrane | 3 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA | -- |
| GO:0005654 | nucleoplasm | IDA | -- |
| GO:0005737 | cytoplasm | IEA | -- |
| GO:0005829 | cytosol | IDA,TAS | -- |
| GO:0005886 | plasma membrane | TAS | -- |
Pathways & Interactions for CBLB Gene
Pathways by source for CBLB Gene
2 Cell Signaling Technology pathways for CBLB Gene
6 Reactome pathways for CBLB Gene
10 KEGG pathways for CBLB Gene
UniProtKB/Swiss-Prot Q13191-CBLB_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for CBLB Gene
Selected Interacting proteins:
ENSP00000264122
Q13191-CBLB_HUMAN
for CBLB Gene via
STRING
MINT
UniProtKB
IID
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006508 | proteolysis | IBA | -- |
| GO:0006607 | NLS-bearing protein import into nucleus | TAS | 7784085 |
| GO:0007165 | signal transduction | TAS | 7784085 |
| GO:0007166 | cell surface receptor signaling pathway | IEA | -- |
| GO:0007173 | epidermal growth factor receptor signaling pathway | IBA | -- |
Drugs & Compounds for CBLB Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| calcium | Nutra | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
Transcripts for CBLB Gene
mRNA/cDNA for CBLB Gene
- (29) REFSEQ mRNAs :
- (18) Additional mRNA sequences :
- (160) Selected AceView cDNA sequences:
- (9) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for CBLB Gene
CRISPR Products
-
OriGene CRISPR knockouts for CBLB
-
Santa Cruz Biotechnology (SCBT) CRISPR for CBLB
- GenScript: Design CRISPR guide RNA sequences for CBLB
miRNA Products
- Search ViGene Biosciences for CBLB
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CBLB
- Browse OriGene Inhibitory RNA Products For CBLB
-
ViGene Biosciences ready-to-package AAV shRNAs for CBLB gene
Clone Products
- Sino Biological Human cDNA Clone for CBLB
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for CBLB
- VectorBuilder custom plasmid, inducible vectors for CBLB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLB
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
| ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | · | 2d | · | 2e | ^ | 3a | · | 3b | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17 | ^ | 18a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||
| SP5: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP10: |
| ExUns: | 18b | ^ | 19a | · | 19b | ^ | 20 | ^ | 21a | · | 21b | ^ | 22 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | |||||||||||
| SP2: | |||||||||||||
| SP3: | |||||||||||||
| SP4: | - | - | |||||||||||
| SP5: | - | - | - | ||||||||||
| SP6: | |||||||||||||
| SP7: | - | - | - | ||||||||||
| SP8: | |||||||||||||
| SP9: | |||||||||||||
| SP10: |
Expression for CBLB Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Ovary (Reproductive System)
- Cumulus Cells Antral Follicle
- Brain (Nervous System)
This gene is overexpressed in Peripheral blood mononuclear cells (23.7), CD8 Tcells (21.3), and Adrenal (12.5).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for CBLB Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of CBLB Gene:
CBLBSOURCE GeneReport for Unigene cluster for CBLB Gene:
Hs.430589mRNA Expression by UniProt/SwissProt for CBLB Gene:
Q13191-CBLB_HUMAN
Tissue specificity:
Expressed in placenta, heart, lung, kidney, spleen, ovary and testis, as well as fetal brain and liver and hematopoietic cell lines, but not in adult brain, liver, pancreas, salivary gland, or skeletal muscle. Present in lymphocytes (at protein level).
Evidence on tissue expression from TISSUES for CBLB Gene
- Intestine(4.2)
- Nervous system(2.9)
Primer Products
-
OriGene qPCR primer pairs and template standards for CBLB
-
OriGene qPCR primer pairs for CBLB
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for CBLB Gene
Orthologs for CBLB Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | CBLB 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | CBLB 35 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | CBLB 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | CBLB 34 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | CBLB 35 |
|
OneToOne | |
| rat (Rattus norvegicus) |
Mammalia | Cblb 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Cblb 34 16 35 |
|
||
| chicken (Gallus gallus) |
Aves | CBLB 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | CBLB 35 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | cblb 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | cblb 34 35 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | Cbl 36 35 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | sli-1 36 35 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 35 |
|
OneToMany |
- Species where no ortholog for CBLB was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for CBLB Gene
(3) SIMAP similar genes for CBLB Gene using alignment to 7 proteins:
Variants for CBLB Gene
| SNP ID | Clin | Chr 03 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs114461789 | untested | 105,720,076(+) | CATCA(C/T)CAAGG | nc-transcript-variant, reference, missense | |
| rs116474782 | untested | 105,720,150(+) | TGCAA(C/T)ACCTG | nc-transcript-variant, reference, missense, utr-variant-5-prime | |
| rs148064625 | untested | 105,702,383(+) | GTGGC(A/G)GTGGA | nc-transcript-variant, reference, missense | |
| rs35835913 | untested | 105,670,275(-) | AAACT(A/G)ACAGA | nc-transcript-variant, reference, missense | |
| rs41302192 | untested | 105,702,188(+) | TTGAA(C/G)TCGCT | nc-transcript-variant, reference, missense |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv4833n100 | CNV | gain | 25217958 |
| dgv8495n54 | CNV | loss | 21841781 |
| dgv8496n54 | CNV | loss | 21841781 |
| esv3575591 | CNV | gain | 25503493 |
| nsv508234 | CNV | deletion | 20534489 |
| nsv511097 | OTHER | complex | 20534489 |
| nsv525071 | CNV | gain | 19592680 |
| nsv591242 | CNV | loss | 21841781 |
| nsv829651 | CNV | loss | 17160897 |
Residual Variation Intolerance Score:
5.51% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.88;
59.04% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for CBLB Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CBLB Gene
Disorders for CBLB Gene
Relevant External Links for CBLB
No disorders were found for CBLB Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CBLB Gene
Publications for CBLB Gene
- Cloning and characterization of cbl-b: a SH3 binding protein with homology to the c-cbl proto-oncogene. (PMID: 7784085) Keane M.M. … Lipkowitz S. (Oncogene 1995) 2 3 4 22 64
- Cbl promotes clustering of endocytic adaptor proteins. (PMID: 16228008) Jozic D. … Bravo J. (Nat. Struct. Mol. Biol. 2005) 3 4 22 64
- CBLB variants in type 1 diabetes and their genetic interaction with CTLA4. (PMID: 15629882) Bergholdt R. … Pociot F. (J. Leukoc. Biol. 2005) 3 22 46 64
- Cbl-c suppresses v-Src-induced transformation through ubiquitin-dependent protein degradation. (PMID: 14661060) Kim M. … Yamamoto T. (Oncogene 2004) 3 4 22 64
- Cbl-b interacts with ubiquitinated proteins; differential functions of the UBA domains of c-Cbl and Cbl-b. (PMID: 15273720) Davies G.C. … Lipkowitz S. (Oncogene 2004) 3 4 22 64
Products for CBLB Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for CBLB
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for CBLB
- Search Origene for MassSpec and Protein Over-expression Lysates for CBLB
- Origene Custom Protein Services for CBLB
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for CBLB
- Browse OriGene Inhibitory RNA Products For CBLB
- OriGene qPCR primer pairs and template standards for CBLB
- OriGene qPCR primer pairs for CBLB
- OriGene CRISPR knockouts for CBLB
- OriGene ORF clones in human for CBLB
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For CBLB
- GenScript: Next-day shipping cDNA ORF clone for CBLB in any vector
- GenScript Custom Purified and Recombinant Proteins Services for CBLB
- GenScript Custom Assay Services for CBLB
- GenScript Custom overexpressing Cell Line Services for CBLB
- GenScript: Design CRISPR guide RNA sequences for CBLB
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for CBLB
- Cell Signaling Technology (CST) Antibodies for CBLB (Cbl-b)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for CBLB
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for CBLB
- Novus Biologicals proteins and lysates for CBLB
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- ViGene Biosciences adenoviral particle packaged cDNA for CBLB gene
- ViGene Biosciences lentiviral particle packaged cDNA for CBLB gene
- ViGene Biosciences ready-to-package AAV shRNAs for CBLB gene
- Search ViGene Biosciences for CBLB
- Santa Cruz Biotechnology (SCBT) Antibodies for CBLB
- Search Santa Cruz Biotechnology (SCBT) for CBLB siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for CBLB
- Horizon Cell Lines for CBLB
- Cyagen custom Knockout/knockin (KOKI) mouse models for CBLB
- VectorBuilder custom plasmid, inducible vectors for CBLB
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for CBLB
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for CBLB Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer