Free for academic non-profit institutions. Other users need a Commercial license

CAMK1G Gene(Protein Coding)

Calcium/Calmodulin Dependent Protein Kinase IG

GCID:
GC01P209583
GIFtS:
58
Genes Participants
UDN Logo

Aliases for CAMK1G Gene

Aliases for CAMK1G Gene

  • Calcium/Calmodulin Dependent Protein Kinase IG 2 3 5
  • CaMK-Like CREB Kinase III 3 4
  • CaM Kinase I Gamma 3 4
  • CaM Kinase IG 3 4
  • CaM-KI Gamma 3 4
  • EC 2.7.11.17 4 61
  • CaMKI Gamma 3 4
  • CLICK III 3 4
  • CaMKIG 3 4
  • CLICK3 3 4
  • VWS1 3 4
  • Calcium/Calmodulin-Dependent Protein Kinase Type 1G 3
  • Calcium/Calmodulin-Dependent Protein Kinase IG 2
  • DJ272L16.1 3
  • EC 2.7.11 61
  • CLICKIII 3

External Ids for CAMK1G Gene

Previous GeneCards Identifiers for CAMK1G Gene

  • GC01P208396
  • GC01P205462
  • GC01P206396
  • GC01P206836
  • GC01P206145
  • GC01P207823
  • GC01P209757
  • GC01P180432

Summaries for CAMK1G Gene

Entrez Gene Summary for CAMK1G Gene

  • This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known. [provided by RefSeq, Jul 2008]

GeneCards Summary for CAMK1G Gene

CAMK1G (Calcium/Calmodulin Dependent Protein Kinase IG) is a Protein Coding gene. Among its related pathways are MAPK-Erk Pathway and Development ERBB-family signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CAMK1D.

UniProtKB/Swiss-Prot for CAMK1G Gene

  • Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates transcription factor CREB1 (By similarity).

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for CAMK1G Gene

Genomics for CAMK1G Gene

Products:

  1. Regulatory Element

Regulatory Elements for CAMK1G Gene

Enhancers for CAMK1G Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G209644 2.1 FANTOM5 Ensembl ENCODE dbSUPER 10.6 +69.3 69295 16.6 CREB3L1 MLX DMAP1 FEZF1 YY1 SLC30A9 ZNF143 ZNF263 SP3 NFYC G0S2 LAMB3 HSD11B1 LOC101930114 CAMK1G ENSG00000224260 MIR205 MIR205HG IRF6 TRAF3IP3
GH01G209607 1.2 Ensembl ENCODE dbSUPER 15.5 +24.3 24273 1.1 HDGF BHLHE40 BACH1 JUNB EBF1 DPF2 RELA FOSL1 JUND TARDBP ENSG00000224260 CAMK1G HSD11B1 G0S2 LOC101930114 MIR4260
GH01G209641 1.3 Ensembl ENCODE dbSUPER 10.7 +59.1 59131 3.4 BCOR CTCF ESRRA ZSCAN4 MAX ZMYM3 ZBTB40 RAD21 YY1 FOSL1 G0S2 LAMB3 HSD11B1 LOC101930114 CAMK1G ENSG00000224260 MIR4260
GH01G209633 1.1 FANTOM5 dbSUPER 11.3 +49.8 49806 0.2 ARNT GTF2E2 RBBP5 ZNF384 ZBTB40 RELA FOSL1 ZNF316 ELK1 NFE2 LAMB3 G0S2 CAMK1G HSD11B1 ENSG00000224260 LOC101930114 MIR4260
GH01G209667 1.1 FANTOM5 dbSUPER 10.7 +84.3 84341 0.4 CTCF PKNOX1 ESRRA ATF1 CEBPG FOSL1 NR2F6 RELB FOS IKZF2 G0S2 CAMK1G ENSG00000224260 LAMB3 TRAF3IP3 C1orf74
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around CAMK1G on UCSC Golden Path with GeneCards custom track

Transcription factor binding sites by QIAGEN in the CAMK1G gene promoter:

Genomic Location for CAMK1G Gene

Chromosome:
1
Start:
209,583,700 bp from pter
End:
209,613,939 bp from pter
Size:
30,240 bases
Orientation:
Plus strand

Genomic View for CAMK1G Gene

Genes around CAMK1G on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
CAMK1G Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for CAMK1G Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for CAMK1G Gene

Proteins for CAMK1G Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for CAMK1G Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96NX5-KCC1G_HUMAN
    Recommended name:
    Calcium/calmodulin-dependent protein kinase type 1G
    Protein Accession:
    Q96NX5
    Secondary Accessions:
    • Q86UH5
    • Q9Y3J7

    Protein attributes for CAMK1G Gene

    Size:
    476 amino acids
    Molecular mass:
    53087 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=CAB41259.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for CAMK1G Gene

    Alternative splice isoforms for CAMK1G Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for CAMK1G Gene

Protein Expression for CAMK1G Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for CAMK1G Gene

Q96NX5:
  • GVITYILL
  • QIQKNFA
  • STACGTPGYVAPEVLAQKPYSKAVDCWSIGVI
  • KNFAKSKW
  • GGELFDR
  • ENEIAVL
  • YVAPEVL
  • LKPENLL
  • RDLKPEN
  • VHRDLKP
  • MQLVSGGELFDRI
  • IVHRDLK

Post-translational modifications for CAMK1G Gene

Other Protein References for CAMK1G Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for CAMK1G Gene

Gene Families for CAMK1G Gene

IUPHAR :

Protein Domains for CAMK1G Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for CAMK1G Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q96NX5

UniProtKB/Swiss-Prot:

KCC1G_HUMAN :
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Domain:
  • The autoinhibitory domain overlaps with the calmodulin binding region and interacts in the inactive folded state with the catalytic domain as a pseudosubstrate.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
genes like me logo Genes that share domains with CAMK1G: view

Function for CAMK1G Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line
  7. Flow Cytometry

Molecular function for CAMK1G Gene

GENATLAS Biochemistry:
rat calcium/calmodulin dependent protein kinase 1,gamma homolog
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by Ca(2+)/calmodulin. Binding of calmodulin is thought to result in a conformational change and leads to activation through phosphorylation by CAMKK1 (By similarity).
UniProtKB/Swiss-Prot Function:
Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates transcription factor CREB1 (By similarity).

Enzyme Numbers (IUBMB) for CAMK1G Gene

Gene Ontology (GO) - Molecular Function for CAMK1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003824 catalytic activity IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0004683 calmodulin-dependent protein kinase activity IBA --
genes like me logo Genes that share ontologies with CAMK1G: view
genes like me logo Genes that share phenotypes with CAMK1G: view

Animal Model Products

  • Taconic Biosciences Mouse Models for CAMK1G

CRISPR Products

miRNA for CAMK1G Gene

miRTarBase miRNAs that target CAMK1G

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for CAMK1G Gene

Localization for CAMK1G Gene

Subcellular locations from UniProtKB/Swiss-Prot for CAMK1G Gene

Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for CAMK1G gene
Compartment Confidence
plasma membrane 3
cytosol 3
golgi apparatus 3
nucleus 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for CAMK1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane IEA --
GO:0005622 intracellular IBA --
GO:0005737 cytoplasm IEA --
GO:0005794 Golgi apparatus IEA --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with CAMK1G: view

Pathways & Interactions for CAMK1G Gene

genes like me logo Genes that share pathways with CAMK1G: view

SIGNOR curated interactions for CAMK1G Gene

Activates:

Gene Ontology (GO) - Biological Process for CAMK1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0008152 metabolic process IEA --
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IBA --
GO:0018107 peptidyl-threonine phosphorylation IBA --
genes like me logo Genes that share ontologies with CAMK1G: view

Drugs & Compounds for CAMK1G Gene

Products:

  1. Drug

(3) Drugs for CAMK1G Gene - From: DrugBank and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
5-[(E)-(5-CHLORO-2-OXO-1,2-DIHYDRO-3H-INDOL-3-YLIDENE)METHYL]-N-[2-(DIETHYLAMINO)ETHYL]-2,4-DIMETHYL-1H-PYRROLE-3-CARBOXAMIDE Experimental Pharma Target 0
calcium Nutra 0

(1) Additional Compounds for CAMK1G Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with CAMK1G: view

Transcripts for CAMK1G Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone
  5. Flow Cytometry

mRNA/cDNA for CAMK1G Gene

(3) REFSEQ mRNAs :
(6) Additional mRNA sequences :
(32) Selected AceView cDNA sequences:
(4) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for CAMK1G Gene

Calcium/calmodulin-dependent protein kinase IG:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for CAMK1G Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3a · 3b ^ 4a · 4b · 4c ^ 5a · 5b ^ 6a · 6b · 6c ^ 7a · 7b ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11a · 11b · 11c ·
SP1: - - - - -
SP2: - - - - - -
SP3: - - - - -
SP4: - - - - - - -
SP5: - - -
SP6: - - - - -
SP7: -
SP8: - - - -
SP9: -
SP10:

ExUns: 11d ^ 12 ^ 13
SP1: -
SP2: -
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:

Relevant External Links for CAMK1G Gene

GeneLoc Exon Structure for
CAMK1G
ECgene alternative splicing isoforms for
CAMK1G

Expression for CAMK1G Gene

Products:

  1. Primer

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for CAMK1G Gene

mRNA expression in normal human tissues for CAMK1G Gene
mRNA expression by BioGPS for CAMK1G GenemRNA expression by GTEx for CAMK1G Gene

mRNA differential expression in normal tissues according to GTEx for CAMK1G Gene

This gene is overexpressed in Brain - Cortex (x8.6), Brain - Frontal Cortex (BA9) (x7.0), Brain - Nucleus accumbens (basal ganglia) (x6.6), Brain - Anterior cingulate cortex (BA24) (x6.0), and Brain - Putamen (basal ganglia) (x4.8).

Protein differential expression in normal tissues from HIPED for CAMK1G Gene

This gene is overexpressed in Liver (63.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for CAMK1G Gene



Protein tissue co-expression partners for CAMK1G Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of CAMK1G Gene:

CAMK1G

SOURCE GeneReport for Unigene cluster for CAMK1G Gene:

Hs.199068

mRNA Expression by UniProt/SwissProt for CAMK1G Gene:

Q96NX5-KCC1G_HUMAN
Tissue specificity: Mainly expressed in brain with small amounts in skeletal muscles, kidney, spleen and liver. Strongly expressed in forebrain neocortex, striatum and limbic system.

Evidence on tissue expression from TISSUES for CAMK1G Gene

  • Nervous system(4.5)
genes like me logo Genes that share expression patterns with CAMK1G: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for CAMK1G Gene

Orthologs for CAMK1G Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for CAMK1G Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia CAMK1G 34 35
  • 99.51 (n)
dog
(Canis familiaris)
 Mammalia CAMK1G 34 35
  • 91.11 (n)
cow
(Bos Taurus)
 Mammalia CAMK1G 34 35
  • 90.35 (n)
mouse
(Mus musculus)
 Mammalia Camk1g 34 16 35
  • 87.89 (n)
rat
(Rattus norvegicus)
 Mammalia Camk1g 34
  • 87.39 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia CAMK1G 35
  • 81 (a)
 OneToOne
oppossum
(Monodelphis domestica)
 Mammalia CAMK1G 35
  • 73 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves CAMK1G 34 35
  • 74.02 (n)
lizard
(Anolis carolinensis)
 Reptilia CAMK1G 35
  • 65 (a)
 OneToOne
tropical clawed frog
(Silurana tropicalis)
 Amphibia camk1g 34
  • 70.76 (n)
zebrafish
(Danio rerio)
 Actinopterygii camk1gb 34 35
  • 65.5 (n)
camk1ga 35
  • 58 (a)
 OneToMany
zgc73155 34
fruit fly
(Drosophila melanogaster)
 Insecta CaMKI 36
  • 57 (a)
worm
(Caenorhabditis elegans)
 Secernentea cmk-1 36
  • 57 (a)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes CMK2 37
sea squirt
(Ciona savignyi)
 Ascidiacea -- 35
  • 56 (a)
 OneToMany
Species where no ortholog for CAMK1G was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for CAMK1G Gene

ENSEMBL:
Gene Tree for CAMK1G (if available)
TreeFam:
Gene Tree for CAMK1G (if available)

Paralogs for CAMK1G Gene

Variants for CAMK1G Gene

Sequence variations from dbSNP and Humsavar for CAMK1G Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
VAR_040601 A breast infiltrating ductal carcinoma sample
rs1000052757 -- 209,593,657(+) ACATC(A/G)CCTAA intron-variant
rs1000095736 -- 209,593,278(+) TAATA(A/C)AAGAC intron-variant
rs1000261132 -- 209,588,250(+) TCCCC(A/G)TATCC intron-variant, nc-transcript-variant
rs1000345097 -- 209,598,953(+) AAGAA(C/T)AGCTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for CAMK1G Gene

Variant ID Type Subtype PubMed ID
esv2672471 CNV deletion 23128226
esv3575639 CNV gain 25503493
esv3588705 CNV loss 21293372

Variation tolerance for CAMK1G Gene

Residual Variation Intolerance Score: 30.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.24; 62.29% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for CAMK1G Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
CAMK1G

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for CAMK1G Gene

Disorders for CAMK1G Gene

Relevant External Links for CAMK1G

Genetic Association Database (GAD)
CAMK1G
Human Genome Epidemiology (HuGE) Navigator
CAMK1G
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
CAMK1G

No disorders were found for CAMK1G Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for CAMK1G Gene

Publications for CAMK1G Gene

  1. Molecular cloning and characterization of CLICK-III/CaMKIgamma, a novel membrane-anchored neuronal Ca2+/calmodulin-dependent protein kinase (CaMK). (PMID: 12637513) Takemoto-Kimura S. … Bito H. (J. Biol. Chem. 2003) 2 3 4 64
  2. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64
  3. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory S.G. … Bentley D.R. (Nature 2006) 3 4 64
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  5. A preliminary gene map for the Van der Woude syndrome critical region derived from 900 kb of genomic sequence at 1q32-q41. (PMID: 10645953) Schutte B.C. … Murray J.C. (Genome Res. 2000) 3 4 64

Products for CAMK1G Gene

Sources for CAMK1G Gene

Content
Loading form....